2GL7: Beta-catenin/BCL9/Tcf4 complex

Crystal Structure of a beta-catenin/BCL9/Tcf4 complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 31 Oct 2006.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 6
Atoms: 8,429
Mol. weight: 142.32 kDa
Released: 31 Oct 2006

Explore 2GL7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GL7 contains 82 α-helices and 4 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	143-160	18
α-helix	165-180	16
α-helix	182-189	8
α-helix	192-204	13
α-helix	208-221	14
α-helix	225-233	9
α-helix	236-243	8
α-helix	249-265	17
α-helix	269-275	7
α-helix	278-284	7
α-helix	285-287	3
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-328	9
α-helix	334-347	14
α-helix	353-359	7
α-helix	362-367	6
α-helix	375-388	14
α-helix	389-391	3
α-helix	399-408	10
α-helix	414-428	15
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	490-497	8
α-helix	504-517	14
α-helix	521-529	9
α-helix	532-548	17
β-strand	561	1	1
β-strand	564	1	1
α-helix	566-580	15
α-helix	584-592	9
α-helix	596-601	6
α-helix	602-604	3
α-helix	608-621	14
α-helix	625-633	9
α-helix	637-642	6
α-helix	649-660	12

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
α-helix	39-48	10

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	353-373	21

Chain D: 39 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	149-160	12
α-helix	165-178	14
α-helix	182-189	8
α-helix	192-204	13
α-helix	208-221	14
α-helix	225-233	9
α-helix	236-242	7
α-helix	243-245	3
α-helix	249-265	17
α-helix	269-275	7
α-helix	278-284	7
α-helix	285-287	3
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-330	11
α-helix	334-347	14
α-helix	353-359	7
α-helix	362-367	6
α-helix	375-388	14
α-helix	389-391	3
α-helix	399-408	10
α-helix	414-428	15
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	491-496	6
α-helix	504-517	14
α-helix	521-523	3
α-helix	524-529	6
α-helix	532-548	17
β-strand	561	1	2
β-strand	564	1	2
α-helix	566-580	15
α-helix	584-591	8
α-helix	596-601	6
α-helix	602-604	3
α-helix	608-621	14
α-helix	625-633	9
α-helix	637-643	7
α-helix	649-661	13

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
α-helix	42-49	8

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	356-370	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-catenin	A, D	protein	550	Homo sapiens	P35222 (AlphaFold model)
Transcription factor 7-like 2	B, E	protein	53	Homo sapiens	Q9NQB0 (AlphaFold model)
B-cell lymphoma 9 protein	C, F	protein	46	Homo sapiens	O00512 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>2GL7_1 Beta-catenin (chains A, D)
SNLINEQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVS
AIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAI
TTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIIL
ASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR
LVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKM
MVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK
LLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGT
QQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAG
VLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSV
ELTSSLFRTE

Sequence of entity 2 (B, E), FASTA

>2GL7_2 Transcription factor 7-like 2 (chains B, E)
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESE

Sequence of entity 3 (C, F), FASTA

>2GL7_3 B-cell lymphoma 9 protein (chains C, F)
NPDGLSQEQLEHRERSLQTLRDIQRMLFPDEKEFTGAQSGGPQQNP

Primary citation

Crystal Structure of a beta-Catenin/BCL9/Tcf4 Complex. Sampietro, J., Dahlberg, C.L., Cho, U.S. et al. Mol Cell (2006) 24:293-300. DOI 10.1016/j.molcel.2006.09.001 · PubMed

Other PDB entries of the same protein (UniProt P35222 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FQN 1.65 Å, Phosphorylation of self-peptides alters Human Leukocyte Antigen Class I-restricted…
3FQR 1.7 Å, Phosphorylation of self-peptides alters Human Leukocyte Antigen Class I-restricted…
7AFW 1.81 Å, Beta-Catenin in complex with compound 6
1JDH 1.9 Å, Crystal structure of beta-catenin and htcf-4
9I8K 2.0 Å, Beta-catenin armadillo (150-663)
9I8X 2.0 Å, Beta-catenin armadillo with cyclic peptide and Compound 2
8RU3 2.0 Å, Crystal structure of beta-catenin in complex with alpha-helical peptide inhibitor
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
29KL 2.09 Å, Crystal structure of Human Catenin Beta-1 in complex with cyclic beta sheet peptide…
1G3J 2.1 Å, Crystal structure of the XTCF3-cbd/beta-catenin armadillo repeat complex
1T08 2.1 Å, Crystal structure of beta-catenin/ICAT helical domain/unphosphorylated APC R3
3DIW 2.1 Å, c-terminal beta-catenin bound TIP-1 structure

Browse structure collections

About this viewer

MolViewer shows 2GL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.