Crystal structure of Efb-C from Staphylococcus aureus. Determined by X-ray diffraction at 1.25 Å resolution. Released 20 Mar 2007.
Explore 2GOM in 3D Show helices and sheets RCSB PDB PDBe
2GOM contains 7 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 106-124 | 19 | |
| β-strand | 126 | 1 | 1 |
| α-helix | 127-139 | 13 | |
| α-helix | 142-144 | 3 | |
| α-helix | 145-161 | 17 | |
| β-strand | 164 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 107-124 | 18 | |
| β-strand | 126 | 1 | 2 |
| α-helix | 127-139 | 13 | |
| α-helix | 145-161 | 17 | |
| β-strand | 164 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fibrinogen-binding protein | A, B | protein | 61 | Staphylococcus aureus | P68799 (AlphaFold model) |
>2GOM_1 Fibrinogen-binding protein (chains A, B) IKKEQKLIQAQNLVREFEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLV R
A structural basis for complement inhibition by Staphylococcus aureus. Hammel, M., Sfyroera, G., Ricklin, D. et al. Nat Immunol (2007) 8:430-437. DOI 10.1038/ni1450 · PubMed
Other PDB entries of the same protein (UniProt P68799 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2GOM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.