2H2M: N-terminal domain of COMMD1

Solution Structure of the N-terminal domain of COMMD1 (Murr1). Determined by solution NMR. Released 5 Dec 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 837
Mol. weight: 11.91 kDa
Released: 5 Dec 2006

Explore 2H2M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2H2M contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	9-13	5
α-helix	15-18	4
α-helix	32-39	8
α-helix	48-52	5
α-helix	59	1
α-helix	60-65	6
α-helix	76-79	4
α-helix	88-94	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
COMM domain-containing protein 1	A	protein	108	Homo sapiens	Q8N668 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2H2M_1 COMM domain-containing protein 1 (chains A)
MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILK
SIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRES

Primary citation

Solution Structure of the COMMD1 N-terminal Domain. Sommerhalter, M., Zhang, Y., Rosenzweig, A.C. J Mol Biol (2007) 365:715-721. DOI 10.1016/j.jmb.2006.10.030 · PubMed

Other PDB entries of the same protein (UniProt Q8N668 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8P0W 2.9 Å, Structure of the human Commander complex COMMD ring
8F2R 3.12 Å, Human CCC complex
8F2U 3.53 Å, Human CCC complex

Browse structure collections

About this viewer

MolViewer shows 2H2M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.