2HEY: Murine OX40L

Crystal structure of murine OX40L bound to human OX40. Determined by X-ray diffraction at 2.0 Å resolution. Released 29 Aug 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 4,356
Mol. weight: 65.84 kDa
Released: 29 Aug 2006

Explore 2HEY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HEY contains 26 α-helices and 71 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain F: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	58-61	4
β-strand	62-68	7	1
β-strand	69	1	2
β-strand	70-71	2	1
β-strand	74-79	6	1
β-strand	89-90	2	3
β-strand	93-95	3	3
β-strand	98	1	4
β-strand	100-109	10	1
β-strand	116-119	4	1
α-helix	126	1
β-strand	127-129	3	1
α-helix	130-132	3
β-strand	137-146	10	1
β-strand	151-152	2	3
β-strand	153-156	4	1
α-helix	160-165	6
β-strand	167	1	2
β-strand	169-177	9	1
β-strand	183	1	4
α-helix	184-185	2
β-strand	189	1	5

Chain G: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	58-61	4
β-strand	62-68	7	6
β-strand	69	1	7
β-strand	70-71	2	6
β-strand	74-79	6	6
β-strand	89-90	2	8
β-strand	93-95	3	8
β-strand	98	1	9
β-strand	100-110	11	6
β-strand	116-119	4	6
α-helix	125-126	2
β-strand	127-128	2	6
α-helix	129-130	2
β-strand	132	1	6
β-strand	137-146	10	6
β-strand	151-152	2	8
β-strand	153-156	4	6
α-helix	160-164	5
β-strand	167	1	7
β-strand	168-177	10	6
β-strand	183	1	9
α-helix	184-185	2
β-strand	189	1	10

Chain R: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	31	1	5
β-strand	35-38	4	11
β-strand	41-44	4	11
α-helix	45	1
β-strand	46	1	12
α-helix	47	1
β-strand	50-54	5	13
β-strand	63-66	4	13
β-strand	71-72	2	14
β-strand	77	1	12
α-helix	80-81	2
β-strand	82-83	2	14
α-helix	84-87	4
α-helix	89-91	3
β-strand	93-97	5	15
β-strand	100	1	16
β-strand	103	1	16
β-strand	106-109	4	15
α-helix	110	1
β-strand	113-115	3	17
β-strand	125-127	3	17
β-strand	132-133	2	18
α-helix	139-141	3
β-strand	142-143	2	18
α-helix	144-145	2
β-strand	156	1	19
β-strand	165	1	19

Chain T: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	31	1	10
β-strand	35-38	4	20
β-strand	41-44	4	20
α-helix	45	1
β-strand	46	1	21
α-helix	47	1
β-strand	50-54	5	22
β-strand	63-66	4	22
β-strand	71-72	2	23
β-strand	77	1	21
β-strand	82-83	2	23
α-helix	84-87	4
β-strand	93-97	5	24
α-helix	104-105	2
β-strand	106-109	4	24
α-helix	110	1
β-strand	113-115	3	25
β-strand	125-127	3	25
α-helix	128-129	2
β-strand	132-133	2	26
α-helix	139-141	3
β-strand	142-143	2	26
α-helix	144-145	2
β-strand	156	1	27
β-strand	165	1	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor ligand superfamily member 4	F, G	protein	152	Mus musculus	P43488 (AlphaFold model)
Tumor necrosis factor receptor superfamily member 4	R, T	protein	146	Homo sapiens	P43489 (AlphaFold model)

Sequence of entity 1 (F, G), FASTA

>2HEY_1 Tumor necrosis factor ligand superfamily member 4 (chains F, G)
GSHMSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYL
KGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHL
QINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

Sequence of entity 2 (R, T), FASTA

>2HEY_2 Tumor necrosis factor receptor superfamily member 4 (chains R, T)
GSHMLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPC
TWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPW
TNCTLAGKHTLQPASNSSDAICEDRD

Primary citation

The Crystal Structure of the Costimulatory OX40-OX40L Complex. Compaan, D.M., Hymowitz, S.G. Structure (2006) 14:1321-1330. DOI 10.1016/j.str.2006.06.015 · PubMed

Other PDB entries of the same protein (UniProt P43488 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HEW 1.45 Å, The X-ray crystal structure of murine OX40L

Browse structure collections

About this viewer

MolViewer shows 2HEY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.