Ultra-high resolution X-ray crystal structure of HIV-1 protease V32I mutant with TMC114 (darunavir) inhibitor. Determined by X-ray diffraction at 0.84 Å resolution. Released 3 Oct 2006.
Explore 2HS1 in 3D Show helices and sheets RCSB PDB PDBe
2HS1 contains 3 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 2 |
| β-strand | 18-24 | 7 | 2 |
| β-strand | 32-33 | 2 | 2 |
| β-strand | 43-49 | 7 | 2 |
| β-strand | 52-66 | 15 | 2 |
| β-strand | 69-77 | 9 | 2 |
| β-strand | 84-85 | 2 | 2 |
| α-helix | 87-90 | 4 | |
| β-strand | 96-98 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 102-103 | 2 | 1 |
| β-strand | 110-115 | 6 | 3 |
| β-strand | 118-124 | 7 | 3 |
| β-strand | 132-133 | 2 | 3 |
| β-strand | 142-149 | 8 | 3 |
| β-strand | 152-166 | 15 | 3 |
| β-strand | 169-177 | 9 | 3 |
| β-strand | 184-185 | 2 | 3 |
| α-helix | 187-190 | 4 | |
| α-helix | 191-193 | 3 | |
| β-strand | 196-198 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| HIV-1 Protease | A, B | protein | 99 | Human immunodeficiency virus 1 | P03366 |
>2HS1_1 HIV-1 Protease (chains A, B) PQITLWKRPLVTIKIGGQLKEALLDTGADDTIIEEMSLPGRWKPKMIGGIGGFIKVRQYD QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
| ID | Name | Formula | Copies |
|---|---|---|---|
| 017 | (3R,3AS,6AR)-HEXAHYDROFURO[2,3-b]furan-3-YL(1S,2R)-3-[[(4-aminophenyl)sulfonyl]… | C27 H37 N3 O7 S | 2 |
Water and common crystallization additives (CL, DMS) are not listed.
Ultra-high Resolution Crystal Structure of HIV-1 Protease Mutant Reveals Two Binding Sites for Clinical Inhibitor TMC114. Kovalevsky, A.Y., Liu, F., Leshchenko, S. et al. J Mol Biol (2006) 363:161-173. DOI 10.1016/j.jmb.2006.08.007 · PubMed
Other PDB entries of the same protein (UniProt P03366), best resolution first:
MolViewer shows 2HS1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.