Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease Inhibitors (II). Determined by X-ray diffraction at 1.26 Å resolution. Released 6 May 2015.
Explore 5AH8 in 3D Show helices and sheets RCSB PDB PDBe
5AH8 contains 3 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| α-helix | 4 | 1 | |
| β-strand | 10-15 | 6 | 2 |
| β-strand | 18-24 | 7 | 2 |
| β-strand | 31-33 | 3 | 2 |
| β-strand | 42-47 | 6 | 2 |
| β-strand | 54-66 | 13 | 2 |
| β-strand | 69-77 | 9 | 2 |
| β-strand | 84-85 | 2 | 2 |
| α-helix | 87-90 | 4 | |
| β-strand | 96-98 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 102-103 | 2 | 1 |
| β-strand | 110-115 | 6 | 3 |
| β-strand | 118-124 | 7 | 3 |
| β-strand | 132-133 | 2 | 3 |
| β-strand | 143-149 | 7 | 3 |
| β-strand | 152-166 | 15 | 3 |
| β-strand | 169-177 | 9 | 3 |
| β-strand | 184-185 | 2 | 3 |
| α-helix | 187-190 | 4 | |
| β-strand | 196-198 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protease | A, B | protein | 99 | HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 (Z2/CDC-Z34 ISOLATE) | P03366 |
>5AH8_1 PROTEASE (chains A, B) PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD QIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF
| ID | Name | Formula | Copies |
|---|---|---|---|
| C7W | (3R,3aS,4R,6aR)-4-(3,3,3-trifluoropropoxy)hexahydrofuro[2,3-b]furan-3-yl… | C32 H41 F3 N4 O9 S | 1 |
Water and common crystallization additives (CL) are not listed.
Disubstituted Bis-Thf Moieties as New P2 Ligands in Non-Peptidal HIV-1 Protease Inhibitors (II). Hohlfeld, K., Wegner, J., Kesteleyn, B. et al. J Med Chem (2015) 58:4029. DOI 10.1021/ACS.JMEDCHEM.5B00358 · PubMed
Other PDB entries of the same protein (UniProt P03366), best resolution first:
MolViewer shows 5AH8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.