Crystal Structure of HIV-1 Protease Mutant I54M with Antiviral Drug Amprenavir. Determined by X-ray diffraction at 1.16 Å resolution. Released 25 Aug 2010.
Explore 3NU6 in 3D Show helices and sheets RCSB PDB PDBe
3NU6 contains 3 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 2 |
| β-strand | 18-24 | 7 | 2 |
| β-strand | 31-33 | 3 | 2 |
| β-strand | 42-49 | 8 | 2 |
| β-strand | 52-66 | 15 | 2 |
| β-strand | 69-77 | 9 | 2 |
| β-strand | 84-85 | 2 | 2 |
| α-helix | 87-90 | 4 | |
| α-helix | 91-93 | 3 | |
| β-strand | 96-98 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 3 |
| β-strand | 18-24 | 7 | 3 |
| β-strand | 32-33 | 2 | 3 |
| β-strand | 43-49 | 7 | 3 |
| β-strand | 52-66 | 15 | 3 |
| β-strand | 69-77 | 9 | 3 |
| β-strand | 84-85 | 2 | 3 |
| α-helix | 87-90 | 4 | |
| β-strand | 96-98 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protease | A, B | protein | 99 | Human immunodeficiency virus 1 | P03366 |
>3NU6_1 Protease (chains A, B) PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFMKVRQYD QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
| ID | Name | Formula | Copies |
|---|---|---|---|
| 478 | {3-[(4-amino-benzenesulfonyl)-isobutyl-amino]-1-benzyl-2-hydroxy-propyl}-carbam… | C25 H35 N3 O6 S | 1 |
Water and common crystallization additives (CL, NA, ACT) are not listed.
Amprenavir complexes with HIV-1 protease and its drug-resistant mutants altering hydrophobic clusters. Shen, C.H., Wang, Y.F., Kovalevsky, A.Y. et al. FEBS J (2010) 277:3699-3714. DOI 10.1111/j.1742-4658.2010.07771.x · PubMed
Other PDB entries of the same protein (UniProt P03366), best resolution first:
MolViewer shows 3NU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.