2HXX: Aminotryptophan Barstar

Aminotryptophan Barstar. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 Aug 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Bacillus amyloliquefaciens
Chains: 2
Atoms: 1,508
Mol. weight: 20.35 kDa
Released: 22 Aug 2006

Explore 2HXX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HXX contains 9 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	7-9	3
α-helix	13-23	11
α-helix	34-43	10
β-strand	49-54	6	1
α-helix	56-61	6
α-helix	66-79	14
β-strand	84-88	5	1

Chain B: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	7-9	3
α-helix	13-24	12
α-helix	34-43	10
β-strand	49-54	6	1
α-helix	68-79	12
β-strand	84-88	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Barstar	A, B	protein	89	Bacillus amyloliquefaciens	P11540 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2HXX_1 Barstar (chains A, B)
KKAVINGEQIRSISDLHQTLKKELALAEYYGENLDALWDALTGWVEYPLVLEWRQFEQSK
QLTENGAESVLQVFREAKAEGADITIILS

Primary citation

Aminotryptophan-containing barstar. Rubini, M., Lepthien, S., Golbik, R. et al. Biochim Biophys Acta (2006) 1764:1147-1158. DOI 10.1016/j.bbapap.2006.04.012 · PubMed

Other PDB entries of the same protein (UniProt P11540 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PQK 1.2 Å, Cryogenic crystal structure of barnase A43C/S80C bound to barstar C40A/S59C/A67C/C82A
2ZA4 1.58 Å, Crystal Structural Analysis of Barnase-barstar Complex
1AY7 1.7 Å, Ribonuclease sa complex with barstar
1B2S 1.82 Å, Structural response to mutation at a protein-protein interface
1X1Y 1.9 Å, Water-mediate interaction at aprotein-protein interface
1BRS 2.0 Å, Protein-protein recognition: crystal structural analysis of a barnase-barstar complex at…
1B27 2.1 Å, Structural response to mutation at a protein-protein interface
1B2U 2.1 Å, Structural response to mutation at a protein-protein interface
1X1W 2.1 Å, Water-mediate interaction at aprotein-protein interface
3DA7 2.25 Å, A conformationally strained, circular permutant of barnase
7MRX 2.29 Å, Cryogenic crystal structure of barnase A43C/S80C bound to barstar C40A/C82A
1X1U 2.3 Å, Water-mediate interaction at aprotein-protein interface

Browse structure collections

About this viewer

MolViewer shows 2HXX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.