2HYW: Human Annexin A2 with Calcium bound

Human Annexin A2 with Calcium bound. Determined by X-ray diffraction at 2.1 Å resolution. Released 5 Sept 2006.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,408
Mol. weight: 71.27 kDa
Ligands: CA
Released: 5 Sept 2006

Explore 2HYW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HYW contains 40 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	34-46	13
α-helix	52-59	8
α-helix	64-78	15
α-helix	82-89	8
α-helix	92-102	11
α-helix	105-117	13
α-helix	124-133	10
α-helix	136-150	15
α-helix	154-161	8
α-helix	164-174	11
α-helix	178-180	3
α-helix	187-200	14
α-helix	209-218	10
α-helix	221-234	14
α-helix	239-246	8
α-helix	249-278	30
α-helix	284-294	11
α-helix	299-310	12
α-helix	314-321	8
α-helix	324-334	11

Chain B: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	34-46	13
α-helix	52-59	8
α-helix	64-78	15
α-helix	82-89	8
α-helix	92-102	11
α-helix	105-117	13
α-helix	124-133	10
α-helix	136-150	15
α-helix	154-161	8
α-helix	164-174	11
α-helix	178-182	5
α-helix	187-200	14
α-helix	209-218	10
α-helix	221-234	14
α-helix	239-246	8
α-helix	249-278	30
α-helix	284-294	11
α-helix	299-310	12
α-helix	314-321	8
α-helix	324-334	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Annexin A2	A, B	protein	308	Homo sapiens	P07355 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2HYW_1 Annexin A2 (chains A, B)
NFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSAL
SGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMY
KTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVP
KWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFA
DRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKAL
LYLCGGDD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	14

Primary citation

Crystallographic Analysis of Calcium-dependent Heparin Binding to Annexin A2. Shao, C., Zhang, F., Kemp, M.M. et al. J Biol Chem (2006) 281:31689-31695. DOI 10.1074/jbc.M604502200 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2

Browse structure collections

About this viewer

MolViewer shows 2HYW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.