5LPX: Annexin A2

Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2. Determined by X-ray diffraction at 1.9 Å resolution. Released 5 Jul 2017.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,006
Mol. weight: 39.04 kDa
Ligands: CA
Released: 5 Jul 2017

Explore 5LPX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LPX contains 21 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	32-47	16
α-helix	53-60	8
α-helix	65-79	15
α-helix	83-90	8
α-helix	93-103	11
α-helix	106-118	13
α-helix	125-134	10
α-helix	137-151	15
α-helix	155-162	8
α-helix	165-175	11
α-helix	179-183	5
α-helix	188-201	14
α-helix	210-219	10
α-helix	222-235	14
α-helix	240-247	8
α-helix	250-264	15
α-helix	266-278	13
α-helix	285-295	11
α-helix	300-311	12
α-helix	315-322	8
α-helix	325-335	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Annexin A2	A	protein	339	Homo sapiens	P07355 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5LPX_1 Annexin A2 (chains A)
XSTVHEILCKLSLEGDHSTPPSAYGEVKAYTNFDAERDALNIETAIKTKGVDEVTIVNIL
TNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDM
LESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	5

Water and common crystallization additives (GOL) are not listed.

Primary citation

Regulation of the Equilibrium between Closed and Open Conformations of Annexin A2 by N-Terminal Phosphorylation and S100A4-Binding. Ecsedi, P., Kiss, B., Gogl, G. et al. Structure (2017) 25:1195-1207.e5. DOI 10.1016/j.str.2017.06.001 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2
2HYW 2.1 Å, Human Annexin A2 with Calcium bound

Browse structure collections

About this viewer

MolViewer shows 5LPX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.