7PCB: The PDZ domain of SNX27 fused with ANXA2

The PDZ domain of SNX27 fused with ANXA2. Determined by X-ray diffraction at 2.0 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,561
Mol. weight: 47.51 kDa
Ligands: CA
Released: 20 Apr 2022

Explore 7PCB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PCB contains 25 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	42-47	6	1
β-strand	55-58	4	1
β-strand	70	1	2
β-strand	73	1	2
β-strand	80-84	5	1
α-helix	89-93	5
α-helix	99	1
β-strand	100-104	5	1
β-strand	107-108	2	1
α-helix	114-122	9
β-strand	127-133	7	1
α-helix	137-139	3
α-helix	147-162	16
α-helix	168-175	8
α-helix	180-194	15
α-helix	198-205	8
α-helix	208-218	11
α-helix	221-232	12
α-helix	240-249	10
α-helix	252-266	15
α-helix	270-277	8
α-helix	280-290	11
α-helix	294-296	3
α-helix	303-315	13
α-helix	325-334	10
α-helix	337-350	14
α-helix	355-362	8
α-helix	365-379	15
α-helix	381-393	13
α-helix	400-409	10
α-helix	412-426	15
α-helix	430-437	8
α-helix	440-450	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-27,Annexin A2	A	protein	420	Homo sapiens	P07355 (AlphaFold model), Q96L92 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7PCB_1 Sorting nexin-27,Annexin A2 (chains A)
GSHMGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAG
VRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADGSAYTNFDAERDA
LNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVI
LGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDI
ISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTE
RSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMK
GKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	5

Water and common crystallization additives (GOL) are not listed.

Primary citation

A scalable strategy to solve structures of PDZ domains and their complexes. Cousido-Siah, A., Carneiro, L., Kostmann, C. et al. Acta Crystallogr D Struct Biol (2022) 78:509-516. DOI 10.1107/S2059798322001784 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
2HYW 2.1 Å, Human Annexin A2 with Calcium bound

Browse structure collections

About this viewer

MolViewer shows 7PCB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.