2HZC: N-terminal RRM of the U2AF large subunit

Crystal structure of the N-terminal RRM of the U2AF large subunit. Determined by X-ray diffraction at 1.47 Å resolution. Released 29 Aug 2006.

Method: X-ray diffraction
Resolution: 1.47 Å
Organism: Homo sapiens
Chains: 1
Atoms: 927
Mol. weight: 10.04 kDa
Ligands: ZN
Released: 29 Aug 2006

Explore 2HZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HZC contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	146-149	4
β-strand	150-154	5	1
α-helix	156-157	2
α-helix	162-175	14
β-strand	186-191	6	1
β-strand	197-202	6	1
α-helix	205-211	7
α-helix	212-214	3
β-strand	218-219	2	2
β-strand	222-223	2	2
β-strand	225-227	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor U2AF 65 kDa subunit	A	protein	87	Homo sapiens	P26368 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HZC_1 Splicing factor U2AF 65 kDa subunit (chains A)
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEF
RSVDETTQAMAFDGIIFQGQSLKIRRP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (P6G) are not listed.

Primary citation

Alternative Conformations at the RNA-binding Surface of the N-terminal U2AF(65) RNA Recognition Motif. Thickman, K.R., Sickmier, E.A., Kielkopf, C.L. J Mol Biol (2007) 366:703-710. DOI 10.1016/j.jmb.2006.11.077 · PubMed

Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0G 1.07 Å, Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution
5W0H 1.11 Å, Structure of U2AF65 (U2AF2) RRM2 at 1.11 Angstrom Resolution
6XLV 1.4 Å, Crystal structure of leukemia-associated N196K mutant of U2AF65 bound to AdML splice site
9C7A 1.4 Å, Crystal structure of R149W neurodevelopmental disease-associated U2AF2 variant
9C7B 1.4 Å, Crystal structure of R150H neurodevelopmental disease-associated U2AF2 variant
7S3A 1.48 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-C5 oligonucleotide
5EV3 1.5 Å, Structure III of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLW 1.5 Å, Crystal structure of U2AF65 bound to AdML splice site sequence
7S3C 1.51 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-A5 oligonucleotide
5EV4 1.57 Å, Structure IV of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLX 1.7 Å, Crystal structure of cancer-associated G301D mutant of U2AF65 bound to AdML splice site
7SN6 1.8 Å, U2AF65 uhm bound to SF3B155 ULM5

Browse structure collections

About this viewer

MolViewer shows 2HZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.