2I46: Human TPP1

Crystal structure of human TPP1. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 Nov 2006.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,304
Mol. weight: 35.12 kDa
Released: 28 Nov 2006

Explore 2I46 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I46 contains 13 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	94	1	1
α-helix	99-104	6
β-strand	113-122	10	2
α-helix	125-127	3
β-strand	142-147	6	2
β-strand	152-157	6	2
α-helix	159-163	5
β-strand	180-192	13	2
β-strand	195	1	3
β-strand	198	1	3
α-helix	199-200	2
β-strand	201-215	15	2
β-strand	223	1	2
α-helix	224-226	3
α-helix	228-238	11

Chain B: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	94	1	1
α-helix	99-104	6
α-helix	108-109	2
β-strand	113-122	10	4
β-strand	142-147	6	4
β-strand	152-157	6	4
α-helix	159-163	5
β-strand	180-192	13	4
α-helix	193-194	2
β-strand	201-215	15	4
β-strand	223	1	4
α-helix	224-226	3
α-helix	228-237	10
α-helix	238-240	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adrenocortical dysplasia protein homolog	A, B	protein	161	Homo sapiens	Q96AP0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2I46_1 Adrenocortical dysplasia protein homolog (chains A, B)
SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDG
THSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRF
SLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNA

Primary citation

The POT1-TPP1 telomere complex is a telomerase processivity factor. Wang, F., Podell, E.R., Zaug, A.J. et al. Nature (2007) 445:506-510. DOI 10.1038/nature05454 · PubMed

Other PDB entries of the same protein (UniProt Q96AP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H65 2.1 Å, Crystal structure of human POT1 and TPP1
5UN7 2.1 Å, Structure of the human POT1-TPP1 telomeric complex
5XYF 2.2 Å, Crystal structure of the human TIN2-TPP1-TRF2 telomeric complex
9Q16 2.7 Å, Human telomerase catalytic core with shelterin protein TPP1, dGpNHpp and DNA primer…
9Q12 2.8 Å, Human telomerase catalytic core with shelterin protein TPP1 and DNA primer ending in TTAG
7S1T 2.9 Å, Structure of the human POT1-TPP1 complex
9Q10 2.9 Å, Human telomerase catalytic core with shelterin protein TPP1, dTpNHpp and DNA primer…
9Q11 2.9 Å, Human telomerase catalytic core with shelterin protein TPP1, BIBR1532, dTpNHpp and DNA…
5I2X 3.0 Å, Crystal Structure of TPP1 K170del
5I2Y 3.0 Å, Crystal Structure of TPP1 K170A
9Q14 3.0 Å, Human telomerase catalytic core with shelterin protein TPP1, BIBR1532 and DNA primer…
9Q0Z 3.1 Å, Human telomerase catalytic core with shelterin protein TPP1, BIBR1532 and DNA primer…

Browse structure collections

About this viewer

MolViewer shows 2I46 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.