2I75: Human Protein Tyrosine Phosphatase N4

Crystal Structure of Human Protein Tyrosine Phosphatase N4 (PTPN4). Determined by X-ray diffraction at 2.45 Å resolution. Released 17 Oct 2006.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,150
Mol. weight: 36.87 kDa
Released: 17 Oct 2006

Explore 2I75 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I75 contains 13 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	639-652	14
α-helix	654-661	8
α-helix	680-682	3
α-helix	692-694	3
β-strand	695-697	3	1
β-strand	704-713	10	1
β-strand	720-726	7	1
α-helix	727-730	4
α-helix	731-733	3
α-helix	734-743	10
β-strand	748-751	4	1
β-strand	756-757	2	2
β-strand	760-761	2	2
α-helix	768-769	2
β-strand	773-776	4	1
β-strand	779-783	5	1
β-strand	787	1	1
β-strand	792-801	10	1
β-strand	806-815	10	1
α-helix	828-841	14
α-helix	847	1
β-strand	848-851	4	1
α-helix	858-873	16
α-helix	880-888	9
α-helix	898-911	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 4	A	protein	320	Homo sapiens	P29074 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2I75_1 Tyrosine-protein phosphatase non-receptor type 4 (chains A)
SMEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFDQLYRKKPG
MTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQG
PLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEG
NTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRAGKEEPV
VVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAI
LKVYEEGFVKPLTTSTNKLT

Primary citation

Large-scale structural analysis of the classical human protein tyrosine phosphatome. Barr, A.J., Ugochukwu, E., Lee, W.H. et al. Cell (2009) 136:352-363. DOI 10.1016/j.cell.2008.11.038 · PubMed

Other PDB entries of the same protein (UniProt P29074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NFK 1.43 Å, Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of a rabies…
2VPH 1.9 Å, Crystal structure of the human protein tyrosine phosphatase, non- receptor type 4, PDZ…
3NFL 1.91 Å, Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of the GluN2A…
5EYZ 2.09 Å, Crystal structure of the PTPN4 PDZ domain complexed with the tailored peptide CYTO8-retev
5EZ0 2.35 Å, Crystal structure of the PTPN4 PDZ domain complexed with the PDZ binding motif of the…
7VZE 2.88 Å, Crystal structure of PTPN4 PDZ bound to the PBM of HPV16 E6
2CS5 Solution structure of PDZ domain of Protein tyrosine phosphatase, non-receptor type 4

Browse structure collections

About this viewer

MolViewer shows 2I75 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.