2IEZ: Mouse Rab27b

Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 May 2007.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 4
Atoms: 5,754
Mol. weight: 100.8 kDa
Ligands: GDP, CA
Released: 1 May 2007

Explore 2IEZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IEZ contains 28 α-helices and 29 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9-15	7	1
α-helix	22-30	9
β-strand	37-53	17	1
β-strand	66-76	11	1
α-helix	80-89	10
β-strand	94-100	7	1
α-helix	105-115	11
α-helix	126	1
β-strand	127-133	7	1
α-helix	138-140	3
α-helix	146-153	8
β-strand	159-161	3	1
β-strand	163	1	2
β-strand	168	1	2
α-helix	170-187	18

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	1
α-helix	22-30	9
β-strand	37-50	14	1
β-strand	69-76	8	1
α-helix	78-89	12
β-strand	94-100	7	1
α-helix	104-114	11
α-helix	117-119	3
β-strand	127-133	7	1
α-helix	138-140	3
α-helix	145-155	11
β-strand	159-161	3	1
α-helix	170-187	18

Chain H: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	3
α-helix	22-30	9
β-strand	37-53	17	4
β-strand	66-76	11	4
α-helix	78-89	12
β-strand	94-100	7	3
α-helix	104-113	10
α-helix	125-126	2
β-strand	127-133	7	3
α-helix	145-153	9
β-strand	159-161	3	3
β-strand	163	1	5
β-strand	168	1	5
α-helix	170-186	17

Chain I: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	4
α-helix	22-29	8
β-strand	37-45	9	4
β-strand	72-73	2	3
β-strand	74-76	3	4
α-helix	79-89	11
β-strand	94-100	7	4
α-helix	104-115	12
α-helix	117-119	3
α-helix	126	1
β-strand	127-133	7	4
α-helix	138-140	3
α-helix	145-153	9
β-strand	159-161	3	4
α-helix	170-187	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-27B	A, B, H, I	protein	220	Mus musculus	Q99P58 (AlphaFold model)

Sequence of entity 1 (A, B, H, I), FASTA

>2IEZ_1 Ras-related protein Rab-27B (chains A, B, H, I)
GSMTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGA
DGASGKAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQ
ANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLL
DLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	4
CA	Calcium ion	Ca	4

Primary citation

Structure of the small GTPase Rab27b shows an unexpected swapped dimer. Chavas, L.M.G., Torii, S., Kamikubo, H. et al. Acta Crystallogr D Biol Crystallogr (2007) 63:769-779. DOI 10.1107/S0907444907019725 · PubMed

Other PDB entries of the same protein (UniProt Q99P58 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IF0 2.8 Å, Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group
2ZET 3.0 Å, Crystal structure of the small GTPase Rab27B complexed with the Slp homology domain of…
2IEY 3.18 Å, Crystal Structure of mouse Rab27b bound to GDP in hexagonal space group

Browse structure collections

About this viewer

MolViewer shows 2IEZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.