2ZET: Small GTPase Rab27B

Crystal structure of the small GTPase Rab27B complexed with the Slp homology domain of Slac2-a/melanophilin. Determined by X-ray diffraction at 3.0 Å resolution. Released 30 Sept 2008.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 4
Atoms: 5,297
Mol. weight: 83.46 kDa
Ligands: ZN, GTP, MG
Released: 30 Sept 2008

Explore 2ZET in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZET contains 29 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	1
α-helix	22-31	10
β-strand	44-54	11	1
β-strand	65-75	11	1
α-helix	82-87	6
α-helix	88-91	4
β-strand	94-100	7	1
α-helix	104-120	17
β-strand	127-133	7	1
α-helix	138-140	3
α-helix	145-154	10
β-strand	159-162	4	1
α-helix	170-185	16

Chain B: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	5
α-helix	22-31	10
β-strand	46-52	7	5
β-strand	67-74	8	5
α-helix	82-86	5
α-helix	89-91	3
β-strand	94-97	4	5
β-strand	98-100	3	6
α-helix	104-120	17
β-strand	127-128	2	5
β-strand	130-133	4	6
α-helix	138-140	3
α-helix	145-155	11
β-strand	159-162	4	6
β-strand	163	1	7
β-strand	168	1	7
α-helix	170-185	16

Chain C: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	12-53	42
α-helix	59-61	3
β-strand	63	1	2
β-strand	70	1	2
α-helix	71-73	3
β-strand	79-80	2	3
β-strand	87-88	2	3
α-helix	90-92	3
β-strand	93-94	2	4
β-strand	103-104	2	4
α-helix	105-117	13
α-helix	119-126	8
α-helix	133-140	8

Chain D: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	12-52	41
α-helix	53-55	3
α-helix	59-62	4
β-strand	63	1	8
β-strand	70	1	8
α-helix	71-73	3
β-strand	79-80	2	9
β-strand	87-88	2	9
α-helix	90-92	3
β-strand	93-94	2	10
β-strand	103-104	2	10
α-helix	105-116	12
α-helix	119-126	8
α-helix	133-140	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-27B	A, B	protein	203	Mus musculus	Q99P58 (AlphaFold model)
Melanophilin	C, D	protein	153	Mus musculus	Q91V27 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2ZET_1 Ras-related protein Rab-27B (chains A, B)
GSMTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGA
DGASGKAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQ
ANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLL
DLIMKRMEKCVEKTQVPDTVNGG

Sequence of entity 2 (C, D), FASTA

>2ZET_2 Melanophilin (chains C, D)
GSSGSSGMGKRLDLSTLTDEEAEHVWAVVQRDFDLRRREEERLQGLKGKIQKESSKRELL
SDTAHLNETHCARCLQPYRLLLNSRRQCLECSLFVCKSCSHAHPEEQGWLCDPCHLARVV
KIGSLEWYYQHVRARFKRFGSAKVIRSLCGRLQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Kukimoto-Niino, M., Sakamoto, A., Kanno, E. et al. Structure (2008) 16:1478-1490. DOI 10.1016/j.str.2008.07.014 · PubMed

Other PDB entries of the same protein (UniProt Q99P58 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IEZ 2.8 Å, Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group
2IF0 2.8 Å, Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group
2IEY 3.18 Å, Crystal Structure of mouse Rab27b bound to GDP in hexagonal space group

Browse structure collections

About this viewer

MolViewer shows 2ZET directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.