2IF0: Mouse Rab27b

Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 May 2007.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,921
Mol. weight: 46.39 kDa
Ligands: GDP, MG
Released: 1 May 2007

Explore 2IF0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IF0 contains 14 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	1
α-helix	22-30	9
β-strand	37-53	17	1
β-strand	66-76	11	1
α-helix	78-89	12
β-strand	94-100	7	1
α-helix	104-114	11
α-helix	126	1
β-strand	127-133	7	1
α-helix	138-140	3
α-helix	145-154	10
β-strand	159-161	3	1
α-helix	170-188	19

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-16	9	1
α-helix	22-30	9
β-strand	37-52	16	1
β-strand	67-76	10	1
α-helix	78-89	12
β-strand	94-100	7	1
α-helix	104-115	12
α-helix	126	1
β-strand	127-133	7	1
α-helix	138-140	3
α-helix	145-155	11
β-strand	159-161	3	1
α-helix	170-185	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-27B	A, B	protein	200	Mus musculus	Q99P58 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2IF0_1 Ras-related protein Rab-27B (chains A, B)
GSMTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGA
DGASGKAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQ
ANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLL
DLIMKRMEKCVEKTQVPDTV

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2
MG	Magnesium ion	Mg	2

Primary citation

Structure of the small GTPase Rab27b shows an unexpected swapped dimer. Chavas, L.M.G., Torii, S., Kamikubo, H. et al. Acta Crystallogr D Biol Crystallogr (2007) 63:769-779. DOI 10.1107/S0907444907019725 · PubMed

Other PDB entries of the same protein (UniProt Q99P58 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IEZ 2.8 Å, Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group
2ZET 3.0 Å, Crystal structure of the small GTPase Rab27B complexed with the Slp homology domain of…
2IEY 3.18 Å, Crystal Structure of mouse Rab27b bound to GDP in hexagonal space group

Browse structure collections

About this viewer

MolViewer shows 2IF0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.