Three-dimensional structure of interleukin 8 in solution. Determined by solution NMR. Released 15 Jan 1991.
Explore 2IL8 in 3D Show helices and sheets RCSB PDB PDBe
2IL8 contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 19-21 | 3 | |
| β-strand | 22-28 | 7 | 1 |
| β-strand | 31 | 1 | 2 |
| β-strand | 34 | 1 | 2 |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 47-51 | 5 | 1 |
| α-helix | 56-71 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-8 | A, B | protein | 72 | Homo sapiens | P10145 (AlphaFold model) |
>2IL8_1 INTERLEUKIN-8 (chains A, B) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQR VVEKFLKRAENS
Three-dimensional structure of interleukin 8 in solution. Clore, G.M., Appella, E., Yamada, M. et al. Biochemistry (1990) 29:1689-1696. DOI 10.1021/bi00459a004 · PubMed
Other PDB entries of the same protein (UniProt P10145 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IL8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.