Crystal structure of the PI3-kinase p85 N-terminal SH2 domain. Determined by X-ray diffraction at 1.89 Å resolution. Released 6 Jun 2006.
Explore 2IUG in 3D Show helices and sheets RCSB PDB PDBe
2IUG contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-8 | 4 | |
| β-strand | 13 | 1 | 1 |
| α-helix | 19-26 | 8 | |
| β-strand | 33-38 | 6 | 1 |
| α-helix | 42-44 | 3 | |
| β-strand | 47-53 | 7 | 1 |
| β-strand | 56-62 | 7 | 1 |
| β-strand | 63-65 | 3 | 2 |
| β-strand | 68-70 | 3 | 2 |
| β-strand | 77 | 1 | 2 |
| α-helix | 80-89 | 10 | |
| α-helix | 92-94 | 3 | |
| α-helix | 97-99 | 3 | |
| β-strand | 105-106 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase regulatory alpha subunit | A | protein | 120 | HOMO SAPIENS | P27986 (AlphaFold model) |
>2IUG_1 PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT (chains A) GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKL IKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED
Crystal Structure of the Pi 3-Kinase P85 Amino-Terminal Sh2 Domain and its Phosphopeptide Complexes. Nolte, R.T., Eck, M.J., Schlessinger, J. et al. Nat Struct Biol (1996) 3:364. DOI 10.1038/NSB0496-364 · PubMed
Other PDB entries of the same protein (UniProt P27986 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IUG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.