2IUH: PI3-kinase p85 N-terminal SH2 domain

Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with c-Kit phosphotyrosyl peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Jun 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,119
Mol. weight: 15.31 kDa
Released: 6 Jun 2006

Explore 2IUH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IUH contains 6 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	13	1	1
α-helix	19-25	7
α-helix	29-30	2
β-strand	33-38	6	1
β-strand	47-53	7	1
β-strand	56-62	7	1
β-strand	63-65	3	2
β-strand	68-70	3	2
β-strand	77	1	2
α-helix	80-87	8
α-helix	92-94	3
α-helix	97-99	3
β-strand	105-106	2	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	202-204	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase regulatory alpha subunit	A	protein	120	HOMO SAPIENS	P27986 (AlphaFold model)
C-kit phosphotyrosyl peptide	B	protein	11	HOMO SAPIENS	P10721 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2IUH_1 PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT (chains A)
GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKL
IKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED

Sequence of entity 2 (B), FASTA

>2IUH_2 C-KIT PHOSPHOTYROSYL PEPTIDE (chains B)
TNEYMDMKPGV

Primary citation

Crystal Structure of the Pi 3-Kinase P85 Amino-Terminal Sh2 Domain and its Phosphopeptide Complexes. Nolte, R.T., Eck, M.J., Schlessinger, J. et al. Nat Struct Biol (1996) 3:364. DOI 10.1038/NSB0496-364 · PubMed

Other PDB entries of the same protein (UniProt P27986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJI 0.9 Å, PI3K p85 N-terminal SH2 domain/CD28-derived peptide complex
5AUL 1.1 Å, PI3K p85 C-terminal SH2 domain/CD28-derived peptide complex
7CIO 1.1 Å, Molecular interactions of cytoplasmic region of CTLA-4 with SH2 domains of PI3-kinase
7RNS 1.14 Å, nSH2 domain of p85-alpha subunit of phosphatidylinositol 3-kinase in complex with an…
3I5R 1.7 Å, PI3K SH3 domain in complex with a peptide ligand
1H9O 1.79 Å, Phosphatidylinositol 3-kinase, P85-alpha subunit: C-terminal SH2 domain complexed with a…
2IUG 1.89 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain
1PBW 2.0 Å, Structure of BCR-homology (BH) domain
1PHT 2.0 Å, Phosphatidylinositol 3-kinase P85-alpha subunit SH3 domain, residues 1-85
4JPS 2.2 Å, Co-crystal Structures of the Lipid Kinase PI3K alpha with Pan and Isoform Selective…
7PG5 2.2 Å, Crystal Structure of PI3Kalpha
6PYR 2.21 Å, Human PI3Kdelta in complex with Compound 2-10 ((3S)-3-benzyl-3-methyl-5-[5-(2-methylpyrim…

Browse structure collections

About this viewer

MolViewer shows 2IUH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.