2IXQ: Invasive tip complex from Afa-Dr fibrils

The solution structure of the invasive tip complex from Afa-Dr fibrils. Determined by solution NMR. Released 20 Sept 2006.

Method: Solution NMR
Organism: Escherichia coli
Chains: 2
Atoms: 2,163
Mol. weight: 30.77 kDa
Released: 20 Sept 2006

Explore 2IXQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IXQ contains 0 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	8	1	2
β-strand	18-21	4	3
β-strand	23	1	2
β-strand	26-28	3	1
β-strand	36-39	4	4
β-strand	52-55	4	3
β-strand	62-66	5	3
β-strand	73	1	4
β-strand	83-85	3	4
β-strand	91-93	3	1
β-strand	97-99	3	3
β-strand	108-111	4	5
β-strand	114-115	2	4
β-strand	137-140	4	5

Chain B: 0 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	6
β-strand	6-7	2	7
β-strand	10-13	4	8
β-strand	28	1	9
β-strand	30-31	2	7
β-strand	40-44	5	8
β-strand	49	1	10
β-strand	54	1	10
β-strand	55-58	4	8
β-strand	64-66	3	8
β-strand	69-70	2	11
β-strand	78	1	8
β-strand	84-85	2	8
β-strand	96	1	9
β-strand	97-98	2	11
β-strand	111-121	11	8
β-strand	129-131	3	8
β-strand	133	1	6
β-strand	136-141	6	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein AfaD	A	protein	142	Escherichia coli	Q47038 (AlphaFold model)
Afimbrial adhesin AFA-III	B	protein	143	Escherichia coli	Q57254 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2IXQ_1 Protein AfaD (chains A)
SAELHLESRGGSGTQLRDGAKVATGRIICREAHTGFHVWMNERQVDGRAERYVVQSKDGR
HELRVRTGGDGWSPVKGEGGKGVSRPGQEEQVFFDVMADGNQDIAPGEYRFSVGGACVVP
QEDNKQGFTPSGTTGTTKLTVT

Sequence of entity 2 (B), FASTA

>2IXQ_2 Afimbrial adhesin AFA-III (chains B)
EECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQGKFFLISDN
NRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGY
WAKDNKQGFTPSGTTGTTKLTVT

Primary citation

The solution structure of the invasive tip complex from Afa/Dr fibrils. Cota, E., Jones, C., Simpson, P. et al. Mol Microbiol (2006) 62:356-366. DOI 10.1111/j.1365-2958.2006.05375.x · PubMed

Other PDB entries of the same protein (UniProt Q47038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AXW 1.05 Å, Structure of DraD invasin from uropathogenic Escherichia coli
2FVN The fibrillar tip complex of the Afa/Dr adhesins from pathogen E. coli displays…

Browse structure collections

About this viewer

MolViewer shows 2IXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.