2J1A: Hyaluronidase

Structure of CBM32 from Clostridium perfringens beta-N- acetylhexosaminidase GH84C in complex with galactose. Determined by X-ray diffraction at 1.49 Å resolution. Released 22 Aug 2006.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: CLOSTRIDIUM PERFRINGENS
Chains: 1
Atoms: 1,288
Mol. weight: 16.64 kDa
Ligands: CA, GAL
Released: 22 Aug 2006

Explore 2J1A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J1A contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	628-633	6	1
β-strand	637	1	2
β-strand	643	1	2
α-helix	645-648	4
β-strand	657-658	2	3
α-helix	665	1
β-strand	671-688	18	1
β-strand	697-706	10	1
β-strand	712-719	8	1
β-strand	727-747	21	1
β-strand	759-760	2	3
β-strand	762-766	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hyaluronidase	A	protein	150	CLOSTRIDIUM PERFRINGENS	Q0TR53 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2J1A_1 HYALURONIDASE (chains A)
KGIDPFTNPRTVKITASSEETSGENAPASFASDGDMNTFWHSKWSSPAHEGPHHLTLELD
NVYEINKVKYAPRQDSKNGRITGYKVSVSLDGENFTEVKTGTLEDNAAIKFIEFDSVDAK
YVRLDVTDSVSDQANGRGKFATAAEVNVHG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
GAL	beta-D-galactopyranose	C6 H12 O6	1

Primary citation

The Interaction of a Carbohydrate-Binding Module from a Clostridium Perfringens N-Acetyl-Beta-Hexosaminidase with its Carbohydrate Receptor. Ficko-Blean, E., Boraston, A.B. J Biol Chem (2006) 281:37748. DOI 10.1074/JBC.M606126200 · PubMed

Other PDB entries of the same protein (UniProt Q0TR53 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OZN 1.6 Å, The Cohesin-Dockerin Complex of NagJ and NagH from Clostridium perfringens
2W1N 1.8 Å, cohesin and fibronectin type-III double module construct from the Clostridium…
2V5C 2.1 Å, Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure
2VUR 2.2 Å, Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death
2CBI 2.25 Å, Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue…
2X0Y 2.25 Å, Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds
2J62 2.26 Å, Structure of a bacterial O-glcnacase in complex with glcnacstatin
2J7M 2.3 Å, Characterization of a Family 32 CBM
7KHV 2.3 Å, Cpoga in complex with ligand 54
2WB5 2.31 Å, GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular…
2CBJ 2.35 Å, Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue…
2J1E 2.4 Å, High Resolution Crystal Structure of CBM32 from a N-acetyl-beta- hexosaminidase in…

Browse structure collections

About this viewer

MolViewer shows 2J1A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.