Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Feb 2009.
Explore 2VUR in 3D Show helices and sheets RCSB PDB PDBe
2VUR contains 69 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 42-45 | 4 | |
| α-helix | 49-50 | 2 | |
| β-strand | 52-55 | 4 | 1 |
| β-strand | 60-61 | 2 | 2 |
| α-helix | 62-63 | 2 | |
| β-strand | 65-69 | 5 | 1 |
| α-helix | 76-88 | 13 | |
| β-strand | 92-93 | 2 | 1 |
| α-helix | 94 | 1 | |
| β-strand | 102-108 | 7 | 1 |
| α-helix | 114-120 | 7 | |
| β-strand | 133-138 | 6 | 1 |
| β-strand | 141-146 | 6 | 1 |
| α-helix | 149-162 | 14 | |
| β-strand | 164 | 1 | 2 |
| β-strand | 167-168 | 2 | 2 |
| β-strand | 171-175 | 5 | 1 |
| β-strand | 181-185 | 5 | 3 |
| α-helix | 192-194 | 3 | |
| α-helix | 195-207 | 13 | |
| β-strand | 212-215 | 4 | 3 |
| α-helix | 221-223 | 3 | |
| α-helix | 230-232 | 3 | |
| α-helix | 233-248 | 16 | |
| β-strand | 252-257 | 6 | 3 |
| α-helix | 259-261 | 3 | |
| α-helix | 267-285 | 19 | |
| β-strand | 291-295 | 5 | 3 |
| α-helix | 304-314 | 11 | |
| α-helix | 315-320 | 6 | |
| α-helix | 321-322 | 2 | |
| α-helix | 325-328 | 4 | |
| β-strand | 329-331 | 3 | 3 |
| α-helix | 337-340 | 4 | |
| β-strand | 341-342 | 2 | 4 |
| β-strand | 345-346 | 2 | 4 |
| α-helix | 348-356 | 9 | |
| β-strand | 362-365 | 4 | 3 |
| β-strand | 375 | 1 | 5 |
| α-helix | 377-387 | 11 | |
| α-helix | 390 | 1 | |
| β-strand | 391-395 | 5 | 3 |
| β-strand | 415 | 1 | 5 |
| α-helix | 419-421 | 3 | |
| β-strand | 423-428 | 6 | 3 |
| α-helix | 437-449 | 13 | |
| α-helix | 456-468 | 13 | |
| α-helix | 469-471 | 3 | |
| α-helix | 472-479 | 8 | |
| β-strand | 485-486 | 2 | 6 |
| β-strand | 492-493 | 2 | 6 |
| α-helix | 496 | 1 | |
| α-helix | 499-513 | 15 | |
| α-helix | 519-542 | 24 | |
| α-helix | 545-576 | 32 | |
| α-helix | 580-599 | 20 | |
| α-helix | 606-610 | 5 | |
| α-helix | 611-617 | 7 | |
| α-helix | 621-623 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 42-45 | 4 | |
| α-helix | 49-50 | 2 | |
| β-strand | 52-55 | 4 | 7 |
| β-strand | 60-61 | 2 | 8 |
| α-helix | 62-63 | 2 | |
| β-strand | 65-69 | 5 | 7 |
| α-helix | 76-88 | 13 | |
| β-strand | 92-93 | 2 | 7 |
| β-strand | 102-108 | 7 | 7 |
| α-helix | 114-120 | 7 | |
| β-strand | 133-138 | 6 | 7 |
| β-strand | 141-146 | 6 | 7 |
| α-helix | 149-162 | 14 | |
| β-strand | 164 | 1 | 8 |
| β-strand | 167-168 | 2 | 8 |
| β-strand | 171-175 | 5 | 7 |
| β-strand | 181-185 | 5 | 9 |
| α-helix | 192-194 | 3 | |
| α-helix | 195-207 | 13 | |
| β-strand | 212-215 | 4 | 9 |
| α-helix | 221-223 | 3 | |
| α-helix | 230-232 | 3 | |
| α-helix | 233-235 | 3 | |
| α-helix | 236-248 | 13 | |
| β-strand | 252-257 | 6 | 9 |
| α-helix | 259-261 | 3 | |
| α-helix | 267-286 | 20 | |
| β-strand | 291-295 | 5 | 9 |
| α-helix | 304-314 | 11 | |
| α-helix | 315-320 | 6 | |
| α-helix | 321-322 | 2 | |
| α-helix | 326-328 | 3 | |
| β-strand | 329-331 | 3 | 9 |
| α-helix | 337-340 | 4 | |
| β-strand | 341-342 | 2 | 10 |
| β-strand | 345-346 | 2 | 10 |
| α-helix | 348-356 | 9 | |
| β-strand | 362-365 | 4 | 9 |
| β-strand | 375 | 1 | 11 |
| α-helix | 377-386 | 10 | |
| β-strand | 391-395 | 5 | 9 |
| β-strand | 415 | 1 | 11 |
| α-helix | 419-421 | 3 | |
| β-strand | 423-428 | 6 | 9 |
| α-helix | 437-449 | 13 | |
| α-helix | 456-468 | 13 | |
| α-helix | 469-471 | 3 | |
| α-helix | 472-479 | 8 | |
| β-strand | 485-486 | 2 | 12 |
| β-strand | 492-493 | 2 | 12 |
| α-helix | 495-496 | 2 | |
| α-helix | 499-513 | 15 | |
| α-helix | 519-542 | 24 | |
| α-helix | 545-576 | 32 | |
| α-helix | 580-599 | 20 | |
| α-helix | 606-610 | 5 | |
| α-helix | 611-617 | 7 | |
| α-helix | 621-623 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| O-glcnacase nagj | A, B | protein | 594 | CLOSTRIDIUM PERFRINGENS | Q0TR53 (AlphaFold model) |
>2VUR_1 O-GLCNACASE NAGJ (chains A, B) VGPKTGEENQVLVPNLNPTPENLEVVGDGFKITSSINLVGEEEADENAVNALREFLTANN IEINSENDPNSTTLIIGEVDDDIPELDEALNGTTAENLKEEGYALVSNDGKIAIEGKDGD GTFYGVQTFKQLVKESNIPEVNITDYPTVSARGIVEGFYGTPWTHQDRLDQIKFYGENKL NTYIYAPKDDPYHREKWREPYPESEMQRMQELINASAENKVDFVFGISPGIDIRFDGDAG EEDFNHLITKAESLYDMGVRSFAIYWDDIQDKSAAKHAQVLNRFNEEFVKAKGDVKPLIT VPTEYDTGAMVSNGQPRAYTRIFAETVDPSIEVMWTGPGVVTNEIPLSDAQLISGIYNRN MAVWWNYPVTDYFKGKLALGPMHGLDKGLNQYVDFFTVNPMEHAELSKISIHTAADYSWN MDNYDYDKAWNRAIDMLYGDLAEDMKVFANHSTRMDNKTWAKSGREDAPELRAKMDELWN KLSSKEDASALIEELYGEFARMEEACNNLKANLPEVALEECSRQLDELITLAQGDKASLD MIVAQLNEDTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALSFDLTLI
| ID | Name | Formula | Copies |
|---|---|---|---|
| YX1 | 2-deoxy-2-{[(2-hydroxy-1-methylhydrazino)carbonyl]amino}-beta-D-glucopyranose | C8 H17 N3 O7 | 2 |
Water and common crystallization additives (SO4) are not listed.
Chemical Dissection of the Link between Streptozotocin, O-Glcnac, and Pancreatic Cell Death. Pathak, S., Dorfmueller, H.C., Borodkin, V.S. et al. Chem Biol (2008) 15:799. DOI 10.1016/J.CHEMBIOL.2008.06.010 · PubMed
Other PDB entries of the same protein (UniProt Q0TR53 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2VUR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.