2OZN: O-GlcNAcase nagJ

Name: PDB 2OZN: The Cohesin-Dockerin Complex of NagJ and NagH from Clostridium perfringens
Published: 2008-05-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

The Cohesin-Dockerin Complex of NagJ and NagH from Clostridium perfringens. Determined by X-ray diffraction at 1.6 Å resolution. Released 6 May 2008.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Clostridium perfringens
Chains: 2
Atoms: 2,313
Mol. weight: 33.11 kDa
Ligands: CA
Released: 6 May 2008

Explore 2OZN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OZN contains 6 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	776-782	7	1
β-strand	786-788	3	2
β-strand	792-803	12	1
β-strand	809-815	7	2
β-strand	821-827	7	1
β-strand	832-840	9	2
β-strand	843-850	8	2
α-helix	855-857	3
β-strand	861-869	9	1
β-strand	873-886	14	2
β-strand	892-894	3	2
β-strand	896	1	1
β-strand	898-905	8	2

Chain B: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	1500-1515	16
β-strand	1518	1	3
β-strand	1525	1	3
α-helix	1529-1544	16
α-helix	1551-1570	20
β-strand	1572	1	3
α-helix	1588-1596	9
α-helix	1616-1627	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
O-GlcNAcase nagJ	A	protein	165	Clostridium perfringens	Q0TR53 (AlphaFold model)
Hyalurononglucosaminidase	B	protein	140	Clostridium perfringens	P26831 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OZN_1 O-GlcNAcase nagJ (chains A)
MGSSHHHHHHSSGLVPRGSHMASKLKENAEVTGSVSLEALEEVQVGENLEVGVGIDELVN
AEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAK
VVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIEGTS

Sequence of entity 2 (B), FASTA

>2OZN_2 Hyalurononglucosaminidase (chains B)
MDKTNLGELINQGKSLLDESVEGFNVGEYHKGAKDGLTVEINKAEEVFNKEDATEEEINL
AKESLEGAIARFNSLLIEESTGDFNGNGKIDIGDLAMVSKNIGSTTNTSLDLNKDGSIDE
YEISFINHRILNLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural basis of Clostridium perfringens toxin complex formation. Adams, J.J., Gregg, K., Bayer, E.A. et al. Proc Natl Acad Sci U S A (2008) 105:12194-12199. DOI 10.1073/pnas.0803154105 · PubMed

Other PDB entries of the same protein (UniProt Q0TR53 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J1A 1.49 Å, Structure of CBM32 from Clostridium perfringens beta-N- acetylhexosaminidase GH84C in…
2W1N 1.8 Å, cohesin and fibronectin type-III double module construct from the Clostridium…
2V5C 2.1 Å, Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure
2VUR 2.2 Å, Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death
2CBI 2.25 Å, Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue…
2X0Y 2.25 Å, Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds
2J62 2.26 Å, Structure of a bacterial O-glcnacase in complex with glcnacstatin
2J7M 2.3 Å, Characterization of a Family 32 CBM
7KHV 2.3 Å, Cpoga in complex with ligand 54
2WB5 2.31 Å, GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular…
2CBJ 2.35 Å, Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue…
2J1E 2.4 Å, High Resolution Crystal Structure of CBM32 from a N-acetyl-beta- hexosaminidase in…

Browse structure collections

About this viewer

MolViewer shows 2OZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.