2J7P: Signal recognition particle protein

Name: PDB 2J7P: GMPPNP-stabilized NG domain complex of the SRP GTPases Ffh and FtsY
Published: 2006-12-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: signal recognition

GMPPNP-stabilized NG domain complex of the SRP GTPases Ffh and FtsY. Determined by X-ray diffraction at 1.97 Å resolution. Released 11 Dec 2006.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: THERMUS AQUATICUS
Chains: 4
Atoms: 9,365
Mol. weight: 130.65 kDa
Ligands: GNP, MG
Released: 11 Dec 2006

Explore 2J7P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J7P contains 48 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	7-14	8
α-helix	24-40	17
α-helix	45-61	17
α-helix	70-85	16
β-strand	99-104	6	1
α-helix	111-123	13
β-strand	129-133	5	1
α-helix	141-152	12
β-strand	156-158	3	1
α-helix	165-178	14
β-strand	183-187	5	1
α-helix	188-190	3
α-helix	196-209	14
β-strand	213-219	7	1
β-strand	222	1	2
α-helix	226-236	11
β-strand	241-245	5	1
α-helix	255-263	9
β-strand	267-271	5	1
β-strand	279-281	3	1
α-helix	284-292	9

Chain B: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	7-14	8
α-helix	21-23	3
α-helix	24-40	17
α-helix	45-61	17
α-helix	70-86	17
α-helix	93-95	3
β-strand	99-104	6	3
α-helix	111-123	13
β-strand	129-133	5	3
α-helix	141-152	12
β-strand	156-158	3	3
α-helix	159-160	2
α-helix	165-178	14
β-strand	183-187	5	3
α-helix	196-209	14
β-strand	213-219	7	3
β-strand	222	1	4
α-helix	226-236	11
β-strand	241-245	5	3
α-helix	255-263	9
β-strand	267-271	5	3
β-strand	279-281	3	3
α-helix	284-292	9

Chain D: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	28-41	14
α-helix	46-59	14
α-helix	64-75	12
β-strand	104-108	5	5
α-helix	115-127	13
β-strand	133-136	4	5
α-helix	145-156	12
β-strand	160-161	2	5
α-helix	169-183	15
β-strand	187-190	4	5
α-helix	200-216	17
β-strand	223-229	7	5
β-strand	232	1	2
α-helix	235-247	13
β-strand	251-255	5	5
α-helix	266-273	8
α-helix	275-276	2
β-strand	277-281	5	5
β-strand	289-291	3	5
α-helix	294-302	9

Chain E: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	28-41	14
α-helix	46-59	14
α-helix	64-75	12
β-strand	104-108	5	6
α-helix	115-127	13
β-strand	133-136	4	6
α-helix	145-156	12
β-strand	160-161	2	6
α-helix	169-183	15
β-strand	187-190	4	6
α-helix	200-216	17
β-strand	223-229	7	6
β-strand	232	1	4
α-helix	235-247	13
β-strand	251-255	5	6
α-helix	266-273	8
α-helix	275-276	2
β-strand	277-281	5	6
β-strand	289-291	3	6
α-helix	294-301	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle protein	A, B	protein	294	THERMUS AQUATICUS	O07347 (AlphaFold model)
Cell division protein ftsy	D, E	protein	283	THERMUS AQUATICUS	P83749 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2J7P_1 SIGNAL RECOGNITION PARTICLE PROTEIN (chains A, B)
MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEAL
GKQVLESLTPAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLAL
YYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEA
RDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVT
GLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGM

Sequence of entity 2 (D, E), FASTA

>2J7P_2 CELL DIVISION PROTEIN FTSY (chains D, E)
IPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPDER
RATLRKLGFNPQKPKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTF
RAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHN
LMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTA
KGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLED

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	4
MG	Magnesium ion	Mg	4

Water and common crystallization additives (EDO, IOD, K) are not listed.

Primary citation

Structure of the Gmppnp-Stabilized Ng Domain Complex of the Srp Gtpases Ffh and Ftsy. Gawronski-Salerno, J., Freymann, D.M. J Struct Biol (2007) 158:122. DOI 10.1016/J.JSB.2006.10.025 · PubMed

Other PDB entries of the same protein (UniProt O07347 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LS1 1.1 Å, T. aquaticus Ffh NG Domain at 1.1A Resolution
2J45 1.14 Å, Water structure of T. Aquaticus Ffh NG Domain At 1.1A Resolution
2J46 1.14 Å, Water structure of T. Aquaticus Ffh NG Domain At 1.1A Resolution
2C04 1.15 Å, GMPPCP complex of SRP GTPase Ffh NG Domain at ultra-high resolution
2C03 1.24 Å, GDP complex of srp gtpase ffh ng domain
1JPN 1.9 Å, GMPPNP Complex of SRP GTPase NG Domain
1RJ9 1.9 Å, Structure of the heterodimer of the conserved GTPase domains of the Signal Recognition…
2NG1 2.02 Å, N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
1NG1 2.03 Å, N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
1FFH 2.05 Å, N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
1OKK 2.05 Å, Homo-heterodimeric complex of the srp gtpases
1O87 2.1 Å, A new MgGDP complex of the Ffh NG domain

Browse structure collections

About this viewer

MolViewer shows 2J7P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.