Fab fragment in complex with small molecule hapten, crystal form-1. Determined by X-ray diffraction at 2.8 Å resolution. Released 8 Jan 2008.
Explore 2JB5 in 3D Show helices and sheets RCSB PDB PDBe
2JB5 contains 11 α-helices and 50 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-24 | 7 | 1 |
| β-strand | 34-39 | 6 | 2 |
| β-strand | 46-51 | 6 | 2 |
| β-strand | 58-60 | 3 | 2 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-101 | 10 | 2 |
| β-strand | 106-110 | 5 | 2 |
| β-strand | 114-118 | 5 | 2 |
| β-strand | 124 | 1 | 3 |
| β-strand | 127-131 | 5 | 4 |
| β-strand | 142-152 | 11 | 4 |
| β-strand | 153 | 1 | 3 |
| β-strand | 158-161 | 4 | 5 |
| α-helix | 162-164 | 3 | |
| β-strand | 166 | 1 | 5 |
| β-strand | 170-172 | 3 | 4 |
| α-helix | 173-175 | 3 | |
| β-strand | 176-177 | 2 | 4 |
| β-strand | 183-192 | 10 | 4 |
| α-helix | 196-198 | 3 | |
| β-strand | 201-207 | 7 | 5 |
| α-helix | 208-210 | 3 | |
| β-strand | 212-218 | 7 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 6 |
| β-strand | 5 | 1 | 7 |
| β-strand | 9-12 | 4 | 8 |
| β-strand | 18-23 | 6 | 7 |
| α-helix | 29-31 | 3 | |
| β-strand | 35-40 | 6 | 8 |
| β-strand | 47-50 | 4 | 8 |
| β-strand | 51 | 1 | 9 |
| β-strand | 55 | 1 | 9 |
| β-strand | 64-69 | 6 | 7 |
| β-strand | 72-77 | 6 | 7 |
| α-helix | 82-84 | 3 | |
| β-strand | 87-93 | 7 | 8 |
| β-strand | 100-102 | 3 | 8 |
| β-strand | 103 | 1 | 6 |
| β-strand | 106-110 | 5 | 8 |
| β-strand | 116 | 1 | 10 |
| β-strand | 119 | 1 | 11 |
| β-strand | 122-123 | 2 | 12 |
| α-helix | 124-126 | 3 | |
| α-helix | 127-131 | 5 | |
| β-strand | 135-139 | 5 | 12 |
| β-strand | 141-144 | 4 | 13 |
| β-strand | 145 | 1 | 10 |
| β-strand | 150-155 | 6 | 14 |
| β-strand | 158-159 | 2 | 14 |
| β-strand | 166 | 1 | 15 |
| β-strand | 177-179 | 3 | 13 |
| β-strand | 181 | 1 | 15 |
| β-strand | 182-185 | 4 | 12 |
| β-strand | 196-202 | 7 | 14 |
| β-strand | 205-211 | 7 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FAB fragment MOR03268 heavy chain | H | protein | 244 | HOMO SAPIENS | P01857 (AlphaFold model) |
| FAB fragment MOR03268 light chain | L | protein | 216 | HOMO SAPIENS | P0DOY2 (AlphaFold model) |
>2JB5_1 FAB FRAGMENT MOR03268 HEAVY CHAIN (chains H) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYAINWVRQAPGQGLEWMGNIEPYFGTANY AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYFMSYKHLSDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSEFEQKLISEEDLNGAPHH HHHH
>2JB5_2 FAB FRAGMENT MOR03268 LIGHT CHAIN (chains L) DIALTQPASVSGSPGQSITISCTGTSSDVGSNNYVSWYQQHPGKAPKLMIYGGSNRPSGV SNRFSGSKSGNTASLTISGLQAEDEADYYCRSWDSNLSYSVFGGGTKLTVLGQPKAAPSV TLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEA
| ID | Name | Formula | Copies |
|---|---|---|---|
| T5C | 2-{(1E,3Z,5E,7E)-7-[3,3-dimethyl-5-sulfo-1-(2-sulfoethyl)-1,3-dihydro-2H-indol-… | C32 H39 N2 O12 S4 | 1 |
Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface. Hillig, R.C., Urlinger, S., Fanghanel, J. et al. J Mol Biol (2008) 377:206. DOI 10.1016/J.JMB.2007.12.071 · PubMed
Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JB5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.