2JCN: BAK1 - a mitochondrial apoptosis regulator

Name: PDB 2JCN: The crystal structure of BAK1 - a mitochondrial apoptosis regulator
Published: 2007-01-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

The crystal structure of BAK1 - a mitochondrial apoptosis regulator. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Jan 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,375
Mol. weight: 19.42 kDa
Released: 4 Jan 2007

Explore 2JCN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JCN contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	24-47	24
α-helix	58-60	3
α-helix	70-100	31
α-helix	107-118	12
α-helix	125-144	20
α-helix	151-164	14
α-helix	167-173	7
α-helix	177-182	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2 homologous antagonist/killer	A	protein	172	HOMO SAPIENS	Q16611 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JCN_1 BCL-2 HOMOLOGOUS ANTAGONIST/KILLER (chains A)
SMSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQL
AIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRL
ALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILN

Primary citation

The Crystal Structure of Bak1 - an Apoptosis Trigger in the Mitochondrial Outer Membrane. Moche, M., Stenmark, P., Arrowsmith, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q16611 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VX1 1.22 Å, Bak L100A
8CZF 1.3 Å, Human BAK in complex with the dF2 peptide
8CZH 1.3 Å, Human BAK in complex with the dM2 peptide
2IMS 1.48 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
2IMT 1.49 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
9CPE 1.49 Å, Structural basis of BAK sequestration by MCL-1 and consequences for apoptosis initiation
5FMI 1.49 Å, Human Bak Q77L
7M5A 1.5 Å, Crystal Structure of human BAK in complex with W3W5_BID
5VWY 1.55 Å, Bak core latch dimer in complex with Bim-h3Pc-RT
5VX0 1.6 Å, Bak in complex with Bim-h3Glg
5VWZ 1.62 Å, Bak in complex with Bim-h3Pc
6UXQ 1.7 Å, Crystal structure of BAK core domain BH3-groove-dimer in complex with POPC and C8E4

Browse structure collections

About this viewer

MolViewer shows 2JCN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.