2JIN: PDZ domain of Synaptojanin-2 binding protein

Crystal structure of PDZ domain of Synaptojanin-2 binding protein. Determined by X-ray diffraction at 1.5 Å resolution. Released 10 Jul 2007.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 967
Mol. weight: 11.3 kDa
Released: 10 Jul 2007

Explore 2JIN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JIN contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	1
β-strand	19	1	2
β-strand	22	1	2
β-strand	25-29	5	1
β-strand	42-47	6	1
α-helix	48	1
α-helix	52-56	5
β-strand	64-68	5	1
β-strand	71-72	2	1
α-helix	78-87	10
β-strand	91-97	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synaptojanin-2 binding protein	A	protein	102	HOMO SAPIENS	P57105 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JIN_1 SYNAPTOJANIN-2 BINDING PROTEIN (chains A)
SMRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQE
GDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRESSI

Primary citation

Crystal Structure of Pdz Domain of Synaptojanin-2 Binding Protein. Tickle, J., Phillips, C., Pike, A.C.W. et al. To be published.

Other PDB entries of the same protein (UniProt P57105 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2JIK 1.35 Å, Crystal structure of PDZ domain of Synaptojanin-2 binding protein
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
8AEL 2.2 Å, SYNJ2BP complex with a synthetic Vangl2 peptide (3mer).
7PC9 2.4 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
7R2M 2.4 Å, SYNJ2BP complex with a synthetic Vangl2 peptide (9mer).
7R2T 2.5 Å, SYNJ2BP complex with a phosphorylated Vangl2 peptide at the P-1 position.
2ENO Solution structure of the PDZ domain from human Synaptojanin 2 binding protein

Browse structure collections

About this viewer

MolViewer shows 2JIN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.