2JNK: Hyalurononglucosaminidase

Name: PDB 2JNK: Solution structure of a dockerin-containing modular pair from a family 84 glycoside hydrolase
Published: 2008-01-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hydrolase

Solution structure of a dockerin-containing modular pair from a family 84 glycoside hydrolase. Determined by solution NMR. Released 29 Jan 2008.

Method: Solution NMR
Organism: Clostridium perfringens
Chains: 1
Atoms: 1,090
Mol. weight: 15.51 kDa
Released: 29 Jan 2008

Explore 2JNK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JNK contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	13-17	5
β-strand	22	1	1
β-strand	25	1	2
β-strand	28	1	2
β-strand	29	1	1
α-helix	33-48	16
α-helix	58-72	15
α-helix	93-98	6
α-helix	99-101	3
α-helix	108-110	3
α-helix	120-131	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hyalurononglucosaminidase	A	protein	140	Clostridium perfringens	P26831 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JNK_1 Hyalurononglucosaminidase (chains A)
MDKTNLGELINQGKSLLDESVEGFNVGEYHKGAKDGLTVEINKAEEVFNKEDATEEEINL
AKESLEGAIARFNSLLIEESTGDFNGNGKIDIGDLAMVSKNIGSTTNTSLDLNKDGSIDE
YEISFINHRILNLEHHHHHH

Primary citation

The solution structure of the C-terminal modular pair from Clostridium perfringens mu-toxin reveals a noncellulosomal dockerin module. Chitayat, S., Adams, J.J., Furness, H.S. et al. J Mol Biol (2008) 381:1202-1212. DOI 10.1016/j.jmb.2008.06.050 · PubMed

Other PDB entries of the same protein (UniProt P26831 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W1S 1.45 Å, Unique ligand binding specificity of a family 32 Carbohydrate-Binding Module from the Mu…
2OZN 1.6 Å, The Cohesin-Dockerin Complex of NagJ and NagH from Clostridium perfringens
2W1Q 1.6 Å, Unique ligand binding specificity for a family 32 Carbohydrate- Binding Module from the…
2W1U 2.0 Å, A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium…
2WDB 2.03 Å, A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium…
7RGA 2.9 Å, Crystal structure of nanoCLAMP3:VHH in complex with MTX

Browse structure collections

About this viewer

MolViewer shows 2JNK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.