Unique ligand binding specificity for a family 32 Carbohydrate- Binding Module from the Mu toxin produced by Clostridium perfringens. Determined by X-ray diffraction at 1.6 Å resolution. Released 5 May 2009.
Explore 2W1Q in 3D Show helices and sheets RCSB PDB PDBe
2W1Q contains 7 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 809-812 | 4 | 1 |
| β-strand | 817-821 | 5 | 1 |
| α-helix | 823-826 | 4 | |
| β-strand | 835-838 | 4 | 1 |
| α-helix | 839 | 1 | |
| α-helix | 840-843 | 4 | |
| β-strand | 845 | 1 | 2 |
| β-strand | 850-868 | 19 | 1 |
| β-strand | 881-887 | 7 | 1 |
| β-strand | 894-900 | 7 | 1 |
| α-helix | 904-905 | 2 | |
| β-strand | 909-928 | 20 | 1 |
| β-strand | 932 | 1 | 2 |
| β-strand | 936-944 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 809-812 | 4 | 3 |
| β-strand | 817-821 | 5 | 3 |
| α-helix | 823-827 | 5 | |
| β-strand | 835-838 | 4 | 3 |
| α-helix | 840-843 | 4 | |
| β-strand | 845 | 1 | 4 |
| β-strand | 850-868 | 19 | 3 |
| β-strand | 881-887 | 7 | 3 |
| β-strand | 894-900 | 7 | 3 |
| α-helix | 904-905 | 2 | |
| β-strand | 909-928 | 20 | 3 |
| β-strand | 932 | 1 | 4 |
| β-strand | 936-944 | 9 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hyaluronoglucosaminidase | A, B | protein | 192 | CLOSTRIDIUM PERFRINGENS | P26831 (AlphaFold model) |
>2W1Q_1 HYALURONOGLUCOSAMINIDASE (chains A, B) MGSSHHHHHHSSGLVPRGSHMASNPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGD TSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTG APAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVSDELENAGNKENVYTNTEL DLLSLAKEDVTK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
| BTB | 2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol | C8 H19 N O5 | 1 |
Water and common crystallization additives (NA) are not listed.
N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh. Ficko-Blean, E., Boraston, A.B. J Mol Biol (2009) 390:208. DOI 10.1016/J.JMB.2009.04.066 · PubMed
Other PDB entries of the same protein (UniProt P26831 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2W1Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.