2JO1: Na,K-ATPase regulatory protein FXYD1 in micelles

Structure of the Na,K-ATPase regulatory protein FXYD1 in micelles. Determined by solution NMR. Released 31 Jul 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 590
Mol. weight: 8.4 kDa
Released: 31 Jul 2007

Explore 2JO1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JO1 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	3-6	4
α-helix	8-10	3
α-helix	14-44	31
α-helix	60-69	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phospholemman	A	protein	72	Homo sapiens	O00168 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JO1_1 Phospholemman (chains A)
ESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTF
RSSIRRLSTRRR

Primary citation

Structure of the Na,K-ATPase regulatory protein FXYD1 in micelles. Teriete, P., Franzin, C.M., Choi, J. et al. Biochemistry (2007) 46:6774-6783. DOI 10.1021/bi700391b · PubMed

Other PDB entries of the same protein (UniProt O00168 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9ROG 2.8 Å, Human alpha3 Na+,K+-ATPase in the Na+-occluded E1P-ADP state obtained under turnover…
9ROH 2.92 Å, Human alpha3 Na+,K+-ATPase in the Na+-occluded E2P state obtained under turnover…
9ROE 2.94 Å, Human alpha3 Na+,K+-ATPase in the outward open E2P state
9ROI 2.94 Å, Human alpha3 Na+,K+-ATPase in the K+-occluded E2P state obtained under turnover conditions
9ROA 3.08 Å, Human alpha3 Na+,K+-ATPase in the Na+-occluded E1P-ADP state
9ROD 3.12 Å, Human alpha3 Na+,K+-ATPase in the Na+-occluded E2P state
9ROP 3.24 Å, Human alpha1 Na+,K+-ATPase in the Na+-occluded E2P state
9RO9 3.27 Å, Human alpha3 Na+,K+-ATPase in the Na+-bound E1-ATP state
9ROF 3.27 Å, Human alpha3 Na+,K+-ATPase in the Na+-bound E1-ATP state obtained under turnover…
9ROQ 3.33 Å, Human alpha1 Na+,K+-ATPase in the outward open E2P state
9RON 3.41 Å, Human alpha1 Na+,K+-ATPase in the Na+-bound E1 state
9ROO 3.5 Å, Human alpha1 Na+,K+-ATPase in the Na+-occluded E1P-ADP state

Browse structure collections

About this viewer

MolViewer shows 2JO1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.