2JO8: Serine/threonine-protein kinase 4

Solution structure of C-terminal domain of human mammalian sterile 20-like kinase 1 (MST1). Determined by solution NMR. Released 15 May 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 856
Mol. weight: 12.24 kDa
Released: 15 May 2007

Explore 2JO8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JO8 contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
α-helix	12-48	37

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	106-109	4
α-helix	112-148	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 4	A, B	protein	51	Homo sapiens	Q13043 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2JO8_1 Serine/threonine-protein kinase 4 (chains A, B)
GSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK

Primary citation

Structural insight into dimeric interaction of the SARAH domains from Mst1 and RASSF family proteins in the apoptosis pathway. Hwang, E., Ryu, K.-S., Paakkonen, K. et al. Proc Natl Acad Sci U S A (2007) 104:9236-9241. DOI 10.1073/pnas.0610716104 · PubMed

Other PDB entries of the same protein (UniProt Q13043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PAV 1.9 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
4NR2 2.0 Å, Crystal structure of STK4 (MST1) SARAH domain
8A5J 2.12 Å, Crystal structure of Human STE20-like kinase 1, MST1 in complex with compound XMU-MP-1
8PAW 2.14 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
3COM 2.2 Å, Crystal structure of Mst1 kinase
4OH8 2.28 Å, Crystal Structure of the human MST1-RASSF5 SARAH heterodimer
5TWG 2.3 Å, human MOB1A bound to human MST1 phosphorylated T353 peptide
9VX3 2.39 Å, Crystal structure of the peptide-bound form of HisMab-1 Fv-clasp
5TWH 2.5 Å, human MOB1A bound to MST1 phosphorylated T367 peptide
7CEA 2.55 Å, Crystal structure of HUTS-4 Fv-clasp fragment
6YAT 2.58 Å, Crystal structure of STK4 (MST1) in complex with compound 6
9IIC 2.78 Å, Crystal structure of HOIP RING2-LDD in complex with STK4 KD domain

Browse structure collections

About this viewer

MolViewer shows 2JO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.