2JQ7: 50S ribosomal protein L11

Model for thiostrepton binding to the ribosomal L11-RNA. Determined by solution NMR. Released 3 Jul 2007.

Method: Solution NMR
Organisms: THERMOTOGA MARITIMA, Escherichia coli, STREPTOMYCES AZUREUS
Chains: 3
Atoms: 2,363
Mol. weight: 35.61 kDa
Released: 3 Jul 2007

Explore 2JQ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JQ7 contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-14	6	1
α-helix	21-29	9
α-helix	35-45	11
α-helix	46-49	4
β-strand	53-60	8	1
β-strand	66-70	5	1
α-helix	72-74	3
α-helix	75-83	9
β-strand	98-101	4	2
α-helix	102-111	10
α-helix	121-133	13
β-strand	137-140	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
50S ribosomal protein L11	A	protein	141	THERMOTOGA MARITIMA	P29395 (AlphaFold model)
Ribosomal RNA	B	RNA	58	Escherichia coli
Thiostrepton	C	protein	19	STREPTOMYCES AZUREUS	P0C8P8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JQ7_1 50S RIBOSOMAL PROTEIN L11 (chains A)
MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITV
YEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANS
LEAAMKIIEGTAKSMGIEVVD

Sequence of entity 2 (B), FASTA

>2JQ7_2 RIBOSOMAL RNA (chains B)
GCUGGGAUGUUGGCUUAGAAGCAGCCAUCAUUUAAAGAGUGCGUAACAGCUCACCAGC

Sequence of entity 3 (C), FASTA

>2JQ7_3 THIOSTREPTON (chains C)
XIASASCTTCICTCSCSSX

Primary citation

L11 Domain Rearrangement Upon Binding to RNA and Thiostrepton Studied by NMR Spectroscopy. Jonker, H.R.A., Ilin, S., Grimm, S.K. et al. Nucleic Acids Res (2007) 35:441. DOI 10.1093/NAR/GKL1066 · PubMed

Other PDB entries of the same protein (UniProt P29395 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MMS 2.57 Å, Crystal structure of the ribosomal PROTEIN L11-RNA complex
4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
4V4R 5.9 Å, Crystal structure of the whole ribosomal complex.
4V4T 6.46 Å, Crystal structure of the whole ribosomal complex with a stop codon in the A-site.
4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.
487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…
1R2W 9.0 Å, Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of the 70S ribosome
1R2X 9.0 Å, Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of EF-Tu ternary…
1PN7 10.8 Å, Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the…
1PN8 10.8 Å, Coordinates of S12, L11 proteins and E-site tRNA from 70S crystal structure separately…
2BCW 11.2 Å, Coordinates of the N-terminal domain of ribosomal protein L11,C-terminal domain of…
1EG0 11.5 Å, Fitting of components with known structure into an 11.5 a cryo-EM map of the e.coli 70S…

Browse structure collections

About this viewer

MolViewer shows 2JQ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.