2JQ8: Vitronectin

Solution structure of the Somatomedin B domain from vitronectin produced in Pichia pastoris. Determined by solution NMR. Released 11 Sept 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 365
Mol. weight: 6.17 kDa
Released: 11 Sept 2007

Explore 2JQ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JQ8 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	25-28	4
α-helix	35-38	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vitronectin	A	protein	53	Homo sapiens	P04004 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JQ8_1 Vitronectin (chains A)
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDHHHHHH

Primary citation

Solution structure of recombinant somatomedin B domain from vitronectin produced in Pichia pastoris. Kjaergaard, M., Gardsvoll, H., Hirschberg, D. et al. Protein Sci (2007) 16:1934-1945. DOI 10.1110/ps.072949607 · PubMed

Other PDB entries of the same protein (UniProt P04004 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RJ9 1.7 Å, Crystal structure of the Vitronectin hemopexin-like domain binding Calcium
6O5E 1.9 Å, Crystal structure of the Vitronectin hemopexin-like domain
1OC0 2.28 Å, plasminogen activator inhibitor-1 complex with somatomedin B domain of vitronectin
3BT2 2.5 Å, Structure of urokinase receptor, urokinase and vitronectin complex
3BT1 2.8 Å, Structure of urokinase receptor, urokinase and vitronectin complex
4K24 4.5 Å, Structure of anti-uPAR Fab ATN-658 in complex with uPAR
1S4G Somatomedin-B Domain of human plasma vitronectin.
1SSU Structural and biochemical evidence for disulfide bond heterogeneity in active forms of…

Browse structure collections

About this viewer

MolViewer shows 2JQ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.