2JQM: Envelope protein E

Yellow Fever Envelope Protein Domain III NMR Structure (S288-K398). Determined by solution NMR. Released 10 Jun 2008.

Method: Solution NMR
Organism: Yellow fever virus
Chains: 1
Atoms: 835
Mol. weight: 11.95 kDa
Released: 10 Jun 2008

Explore 2JQM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JQM contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	298-300	3
β-strand	305-312	8	1
β-strand	318-323	6	1
β-strand	331	1	2
β-strand	334-337	4	3
β-strand	348-349	2	1
β-strand	355	1	2
β-strand	364-368	5	1
α-helix	369-370	2
β-strand	372-378	7	3
β-strand	385-391	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope protein E	A	protein	112	Yellow fever virus	Q6DV88

Sequence of entity 1 (A), FASTA

>2JQM_1 Envelope protein E (chains A)
MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINK
GILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK

Primary citation

Structure of yellow fever virus envelope protein domain III. Volk, D.E., May, F.J., Gandham, S.H. et al. Virology (2009) 394:12-18. DOI 10.1016/j.virol.2009.09.001 · PubMed

Other PDB entries of the same protein (UniProt Q6DV88), best resolution first:

6EPK 2.7 Å, Crystal structure of the precursor membrane protein-envelope protein heterodimer from…
8OFN 3.48 Å, Structure of the yellow fever virus (Asibi strain) dimeric envelope protein
2JV6 YF ED3 Protein NMR Structure

Browse structure collections

About this viewer

MolViewer shows 2JQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.