2JV6: YF ED3 Protein NMR Structure

YF ED3 Protein NMR Structure. Determined by solution NMR. Released 16 Sept 2008.

Method: Solution NMR
Organism: Yellow fever virus
Chains: 1
Atoms: 835
Mol. weight: 11.95 kDa
Released: 16 Sept 2008

Explore 2JV6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JV6 contains 1 α-helix and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	305-312	8	1
β-strand	318-323	6	1
β-strand	330-331	2	2
β-strand	334-337	4	3
α-helix	347	1
β-strand	348-349	2	1
β-strand	355-356	2	2
β-strand	362-368	7	1
β-strand	372	1	4
β-strand	375-378	4	3
β-strand	385-388	4	3
β-strand	391	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope protein E	A	protein	112	Yellow fever virus	Q6DV88

Sequence of entity 1 (A), FASTA

>2JV6_1 Envelope protein E (chains A)
MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINK
GILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK

Primary citation

Yellow Fever Virus Envelope Protein Domain III: A Convergence of Structure and Phylogenetics. Volk, D.E., May, F.J., Gandham, S.H.A. et al. To be published.

Other PDB entries of the same protein (UniProt Q6DV88), best resolution first:

6EPK 2.7 Å, Crystal structure of the precursor membrane protein-envelope protein heterodimer from…
8OFN 3.48 Å, Structure of the yellow fever virus (Asibi strain) dimeric envelope protein
2JQM Yellow Fever Envelope Protein Domain III NMR Structure (S288-K398)

Browse structure collections

About this viewer

MolViewer shows 2JV6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.