8OFN: Envelope glycoprotein

Structure of the yellow fever virus (Asibi strain) dimeric envelope protein. Determined by X-ray diffraction at 3.48 Å resolution. Released 9 Aug 2023.

Method: X-ray diffraction
Resolution: 3.48 Å
Organism: Yellow fever virus
Chains: 2
Atoms: 5,964
Mol. weight: 93.35 kDa
Released: 9 Aug 2023

Explore 8OFN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8OFN contains 30 α-helices and 64 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	8-13	6	1
β-strand	20-26	7	2
β-strand	27	1	1
β-strand	29-35	7	1
β-strand	38-51	14	1
α-helix	53-54	2
β-strand	55-73	19	1
α-helix	83-86	4
β-strand	90-99	10	1
β-strand	109-129	21	1
β-strand	135-143	9	1
α-helix	149-151	3
α-helix	152-155	4
α-helix	156	1
β-strand	157-162	6	1
β-strand	168-172	5	2
β-strand	176-185	10	2
β-strand	193-198	6	1
β-strand	201-206	6	1
α-helix	207-211	5
β-strand	217-219	3	1
β-strand	225-226	2	1
α-helix	228-231	4
β-strand	232-234	3	3
α-helix	235-237	3
β-strand	244-246	3	3
α-helix	247-249	3
α-helix	251-258	8
β-strand	262-266	5	1
α-helix	267	1
β-strand	273-276	4	1
β-strand	280-286	7	2
β-strand	290	1	2
α-helix	297-298	2
β-strand	299	1	4
α-helix	300	1
β-strand	305-312	8	5
β-strand	318-324	7	5
β-strand	330-331	2	4
β-strand	334-337	4	6
β-strand	348-349	2	5
β-strand	355-356	2	4
β-strand	361-368	8	5
α-helix	369-370	2
β-strand	372-378	7	6
β-strand	385-391	7	6

Chain B: 15 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	8-13	6	7
β-strand	20-26	7	8
β-strand	27	1	7
β-strand	29-35	7	7
β-strand	38-51	14	7
α-helix	53-54	2
β-strand	55-73	19	7
α-helix	83-86	4
β-strand	90-99	10	7
β-strand	109-129	21	7
β-strand	135-143	9	7
α-helix	149-151	3
α-helix	152-155	4
α-helix	156	1
β-strand	157-162	6	7
β-strand	168-172	5	8
β-strand	176-184	9	8
β-strand	193-198	6	7
β-strand	201-206	6	7
α-helix	207-211	5
β-strand	217-218	2	7
β-strand	225-226	2	7
α-helix	228-231	4
β-strand	232-234	3	9
α-helix	235-237	3
β-strand	244-246	3	9
α-helix	247-249	3
α-helix	251-258	8
β-strand	262-266	5	7
α-helix	267	1
β-strand	273-276	4	7
β-strand	280-286	7	8
β-strand	290	1	8
α-helix	297-298	2
β-strand	299	1	10
α-helix	300	1
β-strand	305-312	8	11
β-strand	318-324	7	11
β-strand	330-331	2	10
β-strand	334-337	4	12
β-strand	348-349	2	11
β-strand	355-356	2	10
β-strand	361-368	8	11
α-helix	369-370	2
β-strand	372-378	7	12
β-strand	385-391	7	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope glycoprotein	A, B	protein	428	Yellow fever virus	Q6DV88

Sequence of entity 1 (A, B), FASTA

>8OFN_1 Envelope glycoprotein (chains A, B)
AHCIGITDRDFIEGVHGGTWVSATLEQDKCVTVMAPDKPSLDISLETVAIDGPAEARKVC
YNAVLTHVKINDKCPSTGEAHLAEENEGDNACKRTYSDRGWGNGCGLFGKGSIVACAKFT
CAKSMSLFEVDQTKIQYVIRAQLHVGAKQENWNTDIKTLKFDALSGSQEAEFTGYGKATL
ECQVQTAVDFGNSYIAEMEKESWIVDRQWAQDLTLPWQSGSGGVWREMHHLVEFEPPHAA
TIRVLALGNQEGSLKTALTGAMRVTKDTNDNNLYKLHGGHVSCRVKLSALTLKGTSYKMC
TDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINKGILVTVNPIASTND
DEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGLVPRGSSAWSHPQFEKGGSGGGSGGSA
WSHPQFEK

Primary citation

New insight into flavivirus maturation from structure/function studies of the yellow fever virus envelope protein complex. Crampon, E., Covernton, E., Vaney, M.C. et al. mBio (2023) 14:e0070623-e0070623. DOI 10.1128/mbio.00706-23 · PubMed

Other PDB entries of the same protein (UniProt Q6DV88), best resolution first:

6EPK 2.7 Å, Crystal structure of the precursor membrane protein-envelope protein heterodimer from…
2JQM Yellow Fever Envelope Protein Domain III NMR Structure (S288-K398)
2JV6 YF ED3 Protein NMR Structure

Browse structure collections

About this viewer

MolViewer shows 8OFN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.