Solution Structure of the Sla1 SH3-3-Ubiquitin Complex. Determined by solution NMR. Released 25 Sept 2007.
Explore 2JT4 in 3D Show helices and sheets RCSB PDB PDBe
2JT4 contains 4 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15 | 1 | 2 |
| β-strand | 22 | 1 | 1 |
| β-strand | 25 | 1 | 2 |
| β-strand | 30-35 | 6 | 1 |
| β-strand | 42-47 | 6 | 1 |
| β-strand | 53-57 | 5 | 1 |
| α-helix | 58-60 | 3 | |
| β-strand | 61-63 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 3 |
| β-strand | 12-16 | 5 | 3 |
| β-strand | 22 | 1 | 4 |
| α-helix | 23-33 | 11 | |
| β-strand | 41-45 | 5 | 3 |
| β-strand | 48-49 | 2 | 3 |
| α-helix | 50-51 | 2 | |
| β-strand | 55 | 1 | 4 |
| β-strand | 66-71 | 6 | 3 |
| α-helix | 73-75 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoskeleton assembly control protein SLA1 | A | protein | 71 | Saccharomyces cerevisiae | P32790 (AlphaFold model) |
| Ubiquitin | B | protein | 76 | Saccharomyces cerevisiae | P0CG63 (AlphaFold model) |
>2JT4_1 Cytoskeleton assembly control protein SLA1 (chains A) MASKSKKRGIVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQF IEPVRDKKHTE
>2JT4_2 Ubiquitin (chains B) MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGG
Structural Basis for Ubiquitin Recognition by SH3 Domains. He, Y., Hicke, L., Radhakrishnan, I. J Mol Biol (2007) 373:190-196. DOI 10.1016/j.jmb.2007.07.074 · PubMed
Other PDB entries of the same protein (UniProt P32790 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JT4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.