9HDB: Sla1 SH3_3 domain

Sla1 SH3_3 domain (residues 355-414). Determined by X-ray diffraction at 1.49 Å resolution. Released 21 May 2025.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,099
Mol. weight: 14.52 kDa
Released: 21 May 2025

Explore 9HDB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HDB contains 3 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	4
β-strand	14	1	5
β-strand	21	1	4
β-strand	24	1	5
β-strand	29-34	6	4
β-strand	41-46	6	4
β-strand	51	1	3
β-strand	52-56	5	4
α-helix	57-59	3
β-strand	60-62	3	4
α-helix	63	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	14	1	2
β-strand	21	1	1
β-strand	24	1	2
β-strand	29-34	6	1
β-strand	41-46	6	1
β-strand	51	1	3
β-strand	52-56	5	1
α-helix	57-59	3
β-strand	60-63	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin cytoskeleton-regulatory complex protein SLA1	A, B	protein	64	Saccharomyces cerevisiae	P32790 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9HDB_1 Actin cytoskeleton-regulatory complex protein SLA1 (chains A, B)
GAMAKKRGIVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFI
EPVR

Primary citation

Sla2 is a core interaction hub for clathrin light chain and the Pan1/End3/Sla1 complex. Draper-Barr, G., Defelipe, L.A., Ruiz-Carrillo, D. et al. Structure (2025) 33:1193. DOI 10.1016/j.str.2025.04.013 · PubMed

Other PDB entries of the same protein (UniProt P32790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V1Q 1.2 Å, Atomic-resolution structure of the yeast Sla1 SH3 domain 3
1SSH 1.4 Å, Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein…
3IDW 1.85 Å, Crystal structure of Sla1 homology domain 2
1Z9Z 1.95 Å, Crystal structure of yeast sla1 SH3 domain 3
2HBP Solution Structure of Sla1 Homology Domain 1
2JT4 Solution Structure of the Sla1 SH3-3-Ubiquitin Complex

Browse structure collections

About this viewer

MolViewer shows 9HDB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.