2JT4: Sla1 SH3-3-Ubiquitin Complex

Solution Structure of the Sla1 SH3-3-Ubiquitin Complex. Determined by solution NMR. Released 25 Sept 2007.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,173
Mol. weight: 16.75 kDa
Released: 25 Sept 2007

Explore 2JT4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JT4 contains 4 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15	1	2
β-strand	22	1	1
β-strand	25	1	2
β-strand	30-35	6	1
β-strand	42-47	6	1
β-strand	53-57	5	1
α-helix	58-60	3
β-strand	61-63	3	1

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	3
β-strand	12-16	5	3
β-strand	22	1	4
α-helix	23-33	11
β-strand	41-45	5	3
β-strand	48-49	2	3
α-helix	50-51	2
β-strand	55	1	4
β-strand	66-71	6	3
α-helix	73-75	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoskeleton assembly control protein SLA1	A	protein	71	Saccharomyces cerevisiae	P32790 (AlphaFold model)
Ubiquitin	B	protein	76	Saccharomyces cerevisiae	P0CG63 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JT4_1 Cytoskeleton assembly control protein SLA1 (chains A)
MASKSKKRGIVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQF
IEPVRDKKHTE

Sequence of entity 2 (B), FASTA

>2JT4_2 Ubiquitin (chains B)
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGG

Primary citation

Structural Basis for Ubiquitin Recognition by SH3 Domains. He, Y., Hicke, L., Radhakrishnan, I. J Mol Biol (2007) 373:190-196. DOI 10.1016/j.jmb.2007.07.074 · PubMed

Other PDB entries of the same protein (UniProt P32790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V1Q 1.2 Å, Atomic-resolution structure of the yeast Sla1 SH3 domain 3
1SSH 1.4 Å, Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein…
9HDB 1.49 Å, Sla1 SH3_3 domain (residues 355-414)
3IDW 1.85 Å, Crystal structure of Sla1 homology domain 2
1Z9Z 1.95 Å, Crystal structure of yeast sla1 SH3 domain 3
2HBP Solution Structure of Sla1 Homology Domain 1

Browse structure collections

About this viewer

MolViewer shows 2JT4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.