2JU4: Gamma subunit of cGMP phosphodiesterase

NMR structure of the gamma subunit of cGMP phosphodiesterase. Determined by solution NMR. Released 16 Oct 2007.

Method: Solution NMR
Organism: Bos taurus
Chains: 1
Atoms: 819
Mol. weight: 11.86 kDa
Ligands: RCY
Released: 16 Oct 2007

Explore 2JU4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JU4 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	62-65	4
α-helix	81-83	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma	A	protein	87	Bos taurus	P04972 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JU4_1 Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma (chains A)
MNLEPPKAECRSATRVMGGPCTPRKGPPKCKQRQTRQCKSKPPKKGVQGCGDDIPGMEGC
GTDITVICPWEACNHCELHELAQYGIC

Ligands and cofactors

ID	Name	Formula	Copies
RCY	(3'R)-1'-oxyl-2',2',5',5'-tetramethyl-1,3'-bipyrrolidine-2,5-dione	C12 H19 N2 O3	10

Primary citation

Intrinsically disordered gamma-subunit of cGMP phosphodiesterase encodes functionally relevant transient secondary and tertiary structure. Song, J., Guo, L.W., Muradov, H. et al. Proc Natl Acad Sci U S A (2008) 105:1505-1510. DOI 10.1073/pnas.0709558105 · PubMed

Other PDB entries of the same protein (UniProt P04972 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FQJ 2.02 Å, Crystal structure of the heterotrimeric complex of the rgs domain of RGS9, the gamma…
9OHM 2.72 Å, Cryo-EM structure of bovine phosphodiesterase 6 bound to CB-5083
8UGB 3.0 Å, Cryo-EM structure of bovine phosphodiesterase 6 bound to udenafil
9CXI 3.0 Å, Structure of PDE6C in complex with the rod inhibitory p gamma subunit in the absence of…
10OZ 3.06 Å, Structure of PDE5 PDE6 chimera
8UFI 3.1 Å, Cryo-EM structure of bovine phosphodiesterase 6
9CXH 3.1 Å, Structure of PDE6C in complex with the rod inhibitory p gamma subunit in the presence of…
9CXJ 3.1 Å, Structure of PDE6C in complex with the rod inhibitory p gamma subunit with disordered…
7JSN 3.2 Å, Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6
8UGS 3.2 Å, Cryo-EM structure of bovine phosphodiesterase 6 bound to cGMP
8ULG 3.2 Å, Cryo-EM structure of bovine phosphodiesterase 6 bound to IBMX
6MZB 3.4 Å, Cryo-EM structure of phosphodiesterase 6

Browse structure collections

About this viewer

MolViewer shows 2JU4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.