2JW8: Nucleocapsid protein

Solution structure of stereo-array isotope labelled (SAIL) C-terminal dimerization domain of SARS coronavirus nucleocapsid protein. Determined by solution NMR. Released 26 Aug 2008.

Method: Solution NMR
Organism: Human SARS coronavirus
Chains: 2
Atoms: 1,882
Mol. weight: 29.12 kDa
Released: 26 Aug 2008

Explore 2JW8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JW8 contains 19 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	252-255	4
α-helix	271-274	4
α-helix	292-295	4
α-helix	296-298	3
α-helix	302-306	5
α-helix	309-311	3
α-helix	312-315	4
β-strand	322-326	5	1
β-strand	329-339	11	1
α-helix	347-358	12
α-helix	360-363	4

Chain B: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	253-255	3
α-helix	271-274	4
α-helix	282-284	3
α-helix	292-295	4
α-helix	296-298	3
α-helix	303-306	4
α-helix	309-311	3
α-helix	312-315	4
β-strand	322-326	5	1
β-strand	329-338	10	1
α-helix	347-360	14
α-helix	361-363	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleocapsid protein	A, B	protein	128	Human SARS coronavirus	P59595 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2JW8_1 Nucleocapsid protein (chains A, B)
MHHHHHHAMGTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGT
DYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKH
IDAYKTFP

Primary citation

Solution structure of the c-terminal dimerization domain of SARS coronavirus nucleocapsid protein solved by the SAIL-NMR method. Takeda, M., Chang, C.K., Ikeya, T. et al. J Mol Biol (2008) 380:608-622. DOI 10.1016/j.jmb.2007.11.093 · PubMed

Other PDB entries of the same protein (UniProt P59595 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OFZ 1.17 Å, Ultrahigh Resolution Crystal Structure of RNA Binding Domain of SARS Nucleopcapsid (N…
1X7Q 1.45 Å, Crystal structure of HLA-A*1101 with sars nucleocapsid peptide
2GIB 1.75 Å, Crystal structure of the SARS coronavirus nucleocapsid protein dimerization domain
2OG3 1.85 Å, structure of the rna binding domain of n protein from SARS coronavirus in cubic crystal…
7LG0 2.3 Å, Human leukocyte antigen B*07:02 in complex with SARS-CoV2 epitope SPRWYFYYL
6IEX 2.31 Å, Crystal structure of HLA-B*4001 in complex with SARS-CoV derived peptide N216-225…
3I6L 2.4 Å, Newly identified epitope N1 derived from SARS-CoV N protein complexed with HLA-A*2402
2CJR 2.5 Å, Crystal structure of oligomerization domain of SARS coronavirus nucleocapsid protein.
1SSK Structure of the N-terminal RNA-binding Domain of the SARS CoV Nucleocapsid Protein

Browse structure collections

About this viewer

MolViewer shows 2JW8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.