The paxillin-binding domain (PBD) of G Protein Coupled Receptor (GPCR)-kinase (GRK) interacting protein 1 (GIT1). Determined by solution NMR. Released 29 Apr 2008.
Explore 2JX0 in 3D Show helices and sheets RCSB PDB PDBe
2JX0 contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 644 | 1 | |
| β-strand | 645 | 1 | 1 |
| α-helix | 651-673 | 23 | |
| α-helix | 677-696 | 20 | |
| β-strand | 702 | 1 | 1 |
| α-helix | 705-726 | 22 | |
| α-helix | 739-766 | 28 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ARF GTPase-activating protein GIT1 | A | protein | 135 | Rattus norvegicus | Q9Z272 (AlphaFold model) |
>2JX0_1 ARF GTPase-activating protein GIT1 (chains A) GSHMLDGDPDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMA SLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAK AAKQLVTITTREKKQ
GIT1 paxillin-binding domain is a four-helix bundle, and it binds to both paxillin LD2 and LD4 motifs. Zhang, Z.M., Simmerman, J.A., Guibao, C.D. et al. J Biol Chem (2008) 283:18685-18693. DOI 10.1074/jbc.M801274200 · PubMed
Other PDB entries of the same protein (UniProt Q9Z272 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JX0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.