6IUH: GIT1 PBD domain

Crystal structure of GIT1 PBD domain in complex with Liprin-alpha2. Determined by X-ray diffraction at 1.8 Å resolution. Released 20 Feb 2019.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 4
Atoms: 2,582
Mol. weight: 37.83 kDa
Released: 20 Feb 2019

Explore 6IUH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IUH contains 18 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	648-650	3
α-helix	651-673	23
α-helix	677-679	3
α-helix	680-695	16
α-helix	705-725	21
α-helix	726-728	3
α-helix	739-766	28

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	648-650	3
α-helix	651-674	24
α-helix	677-679	3
α-helix	680-695	16
α-helix	705-725	21
α-helix	726-728	3
α-helix	739-766	28

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	638-640	3
α-helix	646-667	22

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	637-640	4
α-helix	646-667	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ARF GTPase-activating protein GIT1	A, B	protein	132	Rattus norvegicus	Q9Z272 (AlphaFold model)
Liprin-alpha-2	C, D	protein	36	Homo sapiens	O75334 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6IUH_1 ARF GTPase-activating protein GIT1 (chains A, B)
GPGSEFDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLF
PKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAK
QLVTITTREKKQ

Sequence of entity 2 (C, D), FASTA

>6IUH_2 Liprin-alpha-2 (chains C, D)
GPGSEFGHSDAQTLAMMLQEQLDAINKEIRLIQEEK

Primary citation

Structural basis of the target-binding mode of the G protein-coupled receptor kinase-interacting protein in the regulation of focal adhesion dynamics. Liang, M., Xie, X., Pan, J. et al. J Biol Chem (2019) 294:5827-5839. DOI 10.1074/jbc.RA118.006915 · PubMed

Other PDB entries of the same protein (UniProt Q9Z272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W6A 1.4 Å, X-ray Structure of the Dimeric GIT1 Coiled-Coil Domain
6IUI 2.6 Å, Crystal structure of GIT1 PBD domain in complex with Paxillin LD4 motif
2JX0 The paxillin-binding domain (PBD) of G Protein Coupled Receptor (GPCR)-kinase (GRK)…

Browse structure collections

About this viewer

MolViewer shows 6IUH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.