6IUI: GIT1 PBD domain

Crystal structure of GIT1 PBD domain in complex with Paxillin LD4 motif. Determined by X-ray diffraction at 2.6 Å resolution. Released 6 Mar 2019.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 4
Atoms: 2,070
Mol. weight: 35.43 kDa
Released: 6 Mar 2019

Explore 6IUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IUI contains 14 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	651-673	23
α-helix	677-679	3
α-helix	680-695	16
α-helix	705-725	21
α-helix	726-728	3
α-helix	739-766	28

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	651-673	23
α-helix	677-679	3
α-helix	680-695	16
α-helix	706-725	20
α-helix	726-728	3
α-helix	739-764	26

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	262-281	20

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	262-279	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ARF GTPase-activating protein GIT1	A, B	protein	132	Rattus norvegicus	Q9Z272 (AlphaFold model)
Paxillin	C, D	protein	28	Homo sapiens	P49023 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6IUI_1 ARF GTPase-activating protein GIT1 (chains A, B)
GPGSEFDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLF
PKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAK
QLVTITTREKKQ

Sequence of entity 2 (C, D), FASTA

>6IUI_2 Paxillin (chains C, D)
GPGSEFSATRELDELMASLSDFKFMAQG

Primary citation

Structural basis of the target-binding mode of the G protein-coupled receptor kinase-interacting protein in the regulation of focal adhesion dynamics. Liang, M., Xie, X., Pan, J. et al. J Biol Chem (2019) 294:5827-5839. DOI 10.1074/jbc.RA118.006915 · PubMed

Other PDB entries of the same protein (UniProt Q9Z272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W6A 1.4 Å, X-ray Structure of the Dimeric GIT1 Coiled-Coil Domain
6IUH 1.8 Å, Crystal structure of GIT1 PBD domain in complex with Liprin-alpha2
2JX0 The paxillin-binding domain (PBD) of G Protein Coupled Receptor (GPCR)-kinase (GRK)…

Browse structure collections

About this viewer

MolViewer shows 6IUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.