2K00: Talin F3

Solution structure of the talin F3 in complex with layilin cytodomain. Determined by solution NMR. Released 9 Sept 2008.

Method: Solution NMR
Organism: Gallus gallus
Chains: 2
Atoms: 870
Mol. weight: 12.35 kDa
Released: 9 Sept 2008

Explore 2K00 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K00 contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	312-317	6	1
α-helix	325	1
β-strand	326-332	7	1
β-strand	336-341	6	1
β-strand	347-352	6	1
α-helix	353-355	3
β-strand	358-361	4	1
β-strand	365-369	5	1
α-helix	371-373	3
β-strand	378-381	4	1
α-helix	385-399	15

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	374-376	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A	protein	92	Gallus gallus	P54939 (AlphaFold model)
Layilin	B	protein	15		Q8C351 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K00_1 Talin-1 (chains A)
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTL
DFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL

Sequence of entity 2 (B), FASTA

>2K00_2 Layilin (chains B)
GRSKESGWVENEIYY

Primary citation

Structural basis for the interaction between the cytoplasmic domain of the hyaluronate receptor layilin and the talin F3 subdomain. Wegener, K.L., Basran, J., Bagshaw, C.R. et al. J Mol Biol (2008) 382:112-126. DOI 10.1016/j.jmb.2008.06.087 · PubMed

Other PDB entries of the same protein (UniProt P54939 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MIX 1.75 Å, Crystal structure of a FERM domain of Talin
1ZVZ 1.8 Å, Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844
1MIZ 1.9 Å, Crystal structure of an integrin beta3-talin chimera
1ZW2 2.1 Å, Vinculin Head (0-258) in Complex with the Talin Rod residues 2345-2369
1MK7 2.2 Å, Crystal structure of an integrin BETA3-talin chimera
1U6H 2.38 Å, Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
1XWJ 2.6 Å, Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
1RKC 2.7 Å, Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues…
8S4Y 2.7 Å, Crystal structure of an APP-talin (F2F3) chimera
1MK9 2.8 Å, Crystal structure of an integrin BETA3-talin chimera
2H7D Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP…
2H7E Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP…

Browse structure collections

About this viewer

MolViewer shows 2K00 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.