Zinc-finger 2 of Nup153. Determined by solution NMR. Released 1 Jul 2008.
Explore 2K0C in 3D Show helices and sheets RCSB PDB PDBe
2K0C contains 0 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-7 | 3 | 1 |
| β-strand | 12-14 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear pore complex protein Nup153 | A | protein | 53 | Rattus norvegicus | P49791 (AlphaFold model) |
>2K0C_1 Nuclear pore complex protein Nup153 (chains A) SDKPASTSGTGFGDKFKPAIGTWDCDTCLVQNKPEAVKCVACETPKPGTGVKR
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
The Crystal Structure of the Ran-Nup153ZnF2 Complex: a General Ran Docking Site at the Nuclear Pore Complex. Schrader, N., Koerner, C., Koessmeier, K. et al. Structure (2008) 16:1116-1125. DOI 10.1016/j.str.2008.03.014 · PubMed
Other PDB entries of the same protein (UniProt P49791 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2K0C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.