2K3F: Ribosomal protein L11 from Thermotoga maritima

Name: PDB 2K3F: Ribosomal protein L11 from Thermotoga maritima
Published: 2008-06-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Ribosomal protein L11 from Thermotoga maritima. Determined by solution NMR. Released 17 Jun 2008.

Method: Solution NMR
Organism: Thermotoga maritima
Chains: 1
Atoms: 1,056
Mol. weight: 15.11 kDa
Released: 17 Jun 2008

Explore 2K3F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K3F contains 9 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	5-15	11	1
α-helix	24	1
α-helix	25-29	5
α-helix	30	1
α-helix	35-45	11
β-strand	52-61	10	1
β-strand	66-70	5	1
α-helix	76-79	4
α-helix	80-84	5
β-strand	98-100	3	2
α-helix	102-111	10
α-helix	113-116	4
α-helix	121-134	14
β-strand	137-139	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
50S ribosomal protein L11	A	protein	141	Thermotoga maritima	P29395 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K3F_1 50S ribosomal protein L11 (chains A)
MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITV
YEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANS
LEAAMKIIEGTAKSMGIEVVD

Primary citation

Domain reorientation and induced fit upon RNA binding: solution structure and dynamics of ribosomal protein L11 from Thermotoga maritima. Ilin, S., Hoskins, A., Ohlenschlager, O. et al. Chembiochem (2005) 6:1611-1618. DOI 10.1002/cbic.200500091 · PubMed

Other PDB entries of the same protein (UniProt P29395 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MMS 2.57 Å, Crystal structure of the ribosomal PROTEIN L11-RNA complex
4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
4V4R 5.9 Å, Crystal structure of the whole ribosomal complex.
4V4T 6.46 Å, Crystal structure of the whole ribosomal complex with a stop codon in the A-site.
4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.
487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…
1R2W 9.0 Å, Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of the 70S ribosome
1R2X 9.0 Å, Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of EF-Tu ternary…
1PN7 10.8 Å, Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the…
1PN8 10.8 Å, Coordinates of S12, L11 proteins and E-site tRNA from 70S crystal structure separately…
2BCW 11.2 Å, Coordinates of the N-terminal domain of ribosomal protein L11,C-terminal domain of…
1EG0 11.5 Å, Fitting of components with known structure into an 11.5 a cryo-EM map of the e.coli 70S…

Browse structure collections

About this viewer

MolViewer shows 2K3F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.