2K6S: Rab11-FIP2 C-terminal Coiled-coil Domain

Structure of Rab11-FIP2 C-terminal Coiled-coil Domain. Determined by solution NMR. Released 16 Jun 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 701
Mol. weight: 10.01 kDa
Released: 16 Jun 2009

Explore 2K6S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K6S contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-34	30
α-helix	35-37	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rab11fip2 protein	A, B	protein	41	Homo sapiens	Q7L804 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2K6S_1 Rab11fip2 protein (chains A, B)
GSLTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVM

Primary citation

Disorder and structure in the Rab11 binding domain of Rab11 family interacting protein 2. Wei, J., Liu, Y., Bose, K. et al. Biochemistry (2009) 48:549-557. DOI 10.1021/bi8020197 · PubMed

Other PDB entries of the same protein (UniProt Q7L804 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TSO 1.8 Å, Structure of the cancer associated Rab25 protein in complex with FIP2
4C4P 2.0 Å, Crystal Structure of Wild-Type Rab11 Complexed to FIP2
6S8X 2.29 Å, Crystal structure of the Rab-binding domain of FIP2
2GZD 2.44 Å, Crystal Structure of Rab11 in Complex with Rab11-FIP2
2GZH 2.47 Å, Crystal Structure of Rab11 in Complex with Rab11-Family Interacting Protein 2

Browse structure collections

About this viewer

MolViewer shows 2K6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.