2K9G: Third SH3 domain of the Cin85 adapter protein

Solution structure of the third SH3 domain of the Cin85 adapter protein. Determined by solution NMR. Released 13 Oct 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 595
Mol. weight: 8.48 kDa
Released: 13 Oct 2009

Explore 2K9G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K9G contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	270-274	5	1
β-strand	278	1	2
β-strand	285	1	1
β-strand	288	1	2
β-strand	293-298	6	1
β-strand	306-311	6	1
β-strand	314-319	6	1
α-helix	320-322	3
β-strand	323-325	3	1
α-helix	326-327	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3 domain-containing kinase-binding protein 1	A	protein	73	Homo sapiens	Q96B97 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K9G_1 SH3 domain-containing kinase-binding protein 1 (chains A)
SMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPD
NFVKLLPPDFEKE

Primary citation

Solution structure of the Sh3-C domain of Cin85. Philippe, D.L. To be published.

Other PDB entries of the same protein (UniProt Q96B97 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ABS 1.74 Å, Crystal structure of the C-terminal coiled-coil domain of CIN85 in space group P321
2BZ8 2.0 Å, N-terminal Sh3 domain of CIN85 bound to Cbl-b peptide
2YDL 2.05 Å, Crystal structure of SH3C from CIN85
2K6D CIN85 Sh3-C domain in complex with ubiquitin
2N64 NMR Structure of the C-terminal Coiled-Coil Domain of CIN85
2O2O Solution structure of domain B from human CIN85 PROTEIN

Browse structure collections

About this viewer

MolViewer shows 2K9G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.